KEGG   Staphylococcus epidermidis RP62A: SERP0768Help
Entry
SERP0768          CDS       T00229                                 

Gene name
carA
Definition
carbamoyl phosphate synthase small subunit (EC:6.3.5.5)
Orthology
K01956  
carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SERP0768 (carA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SERP0768 (carA)
Enzymes [BR:ser01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     SERP0768 (carA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
766435..767535
Genome map
AA seq 366 aa AA seqDB search
MLEKRYLVLEDGSYYEGYRLGSDDLSIGEIVFNTAMTGYQETISDPSYTGQIITFTYPLI
GNYGINRDDFESLTPKLNGVVVKEASTHPSNFRHQKTLHETLAQYHIPGISGVDTRSITR
KIRNHGVLRAGFTDNKDNIQELVEQLKTAELPRDEVQTVSTKTPYVSTGSDLSVVLLDFG
KKQNIVRELNLRGCNVTVVPYDTSAEEILSMSPDGVMLSNGPGDPDEVDVALDMIRGILG
KIPFFGICLGHQLFALSQGATSFKMKFGHRGANHPVKDLRTGKIDITSQNHGYSIDRDSL
KNTDLEVTHIALNDGTVEGLRHKELPAFSVQYHPEARPGPSDSNYLFDEFITMMKDFKEK
ERQINA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaaaacgttatcttgtactggaagatggctcttattacgaaggatatcgctta
gggtcagatgacttatctataggcgaaattgtattcaacactgctatgacggggtaccaa
gaaacaatctctgacccgtcttacacaggtcaaatcataacttttacgtacccactaatt
ggaaactatggtatcaatcgcgatgattttgaatcattaacacctaaattaaatggggta
gtagtaaaggaagcaagtacacaccctagtaactttagacaccaaaaaacattacacgaa
acacttgctcaatatcatattcctggtatatcgggtgtagatactagaagtattactcgt
aaaattagaaatcatggtgttttgagagctggatttacagataataaagataacattcag
gaacttgttgaacagttgaaaactgctgagttacctagagatgaagttcaaacggtttct
acaaaaacaccatatgtatcaacaggttccgatttaagtgtcgttttactcgactttggt
aaaaagcaaaatatcgttcgtgaattaaatttacgtggttgcaacgtcacagttgtacca
tatgatacgtcagctgaagagattttaagcatgtctccagatggtgtcatgctatcaaac
ggccctggtgatccagacgaagttgacgttgctttagatatgatcagaggcatattagga
aagataccattctttggtatctgccttggtcatcaactttttgcattatcgcaaggcgca
acttcattcaaaatgaaatttggacatcgtggtgcgaaccatcccgttaaagatttaaga
acaggtaaaatagatatcacgagccaaaatcacggctattctattgaccgtgactcgctt
aaaaatactgaccttgaagttacacatattgctttaaacgatggtactgttgaaggacta
agacataaagaacttccagcgttttcagtccaatatcatcctgaagcaagaccaggtcca
agtgattctaattacttatttgatgagttcataacaatgatgaaggatttcaaagaaaag
gagcgtcaaatcaatgcctaa

DBGET integrated database retrieval system