KEGG   Staphylococcus epidermidis RP62A: SERP0781Help
Entry
SERP0781          CDS       T00229                                 

Gene name
def-2
Definition
peptide deformylase (EC:3.5.1.31)
Orthology
K01462  
peptide deformylase [EC:3.5.1.88]
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
780762..781250
Genome map
AA seq 162 aa AA seqDB search
MTVKKLVKSTHPILNKTIQPVSTYDQKLKVLLEDLEDTLYHEEAAAISAPQIGVDQSVAL
IDMEQEGLLQLINPVVKSQSQETVSDLEGSISLPHIYGEVKRSKMITVQSYDINGNAVEL
TAYDDIARMILHMIDHLNGIQFTKRAHHILNETEVEAYFDNE
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaaagaaattagtaaaatcaacacatcctattttgaataaaacgattcaacct
gtaagcacgtatgatcaaaaactaaaagtgttattggaagatttggaagatacattatat
catgaggaagccgctgcaattagtgcacctcaaattggagtagatcaaagtgttgcactc
atcgatatggaacaagaagggttattacaacttattaatcctgtcgttaaaagtcaatct
caagagactgtttctgacttagaaggctcaatcagtttacctcatatatatggagaagtt
aaacgtagcaaaatgatcactgtacaaagctatgatatcaatggaaatgcagttgaatta
actgcatatgatgatatcgcacgcatgattttacatatgattgatcatcttaatggaatt
caatttaccaaaagagcacatcatatattaaatgaaactgaagtggaggcgtattttgac
aatgagtaa

DBGET integrated database retrieval system