KEGG   Staphylococcus epidermidis RP62A: SERP0782Help
Entry
SERP0782          CDS       T00229                                 

Gene name
fmt
Definition
methionyl-tRNA formyltransferase (EC:2.1.2.9)
Orthology
K00604  
methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
One carbon pool by folate
Aminoacyl-tRNA biosynthesis
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ser00670]
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:ser00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
781243..782175
Genome map
AA seq 310 aa AA seqDB search
MSKIIFMGTPDFSTKVLEMLIAEHEVIAVVTQPDRPVGRKKVMTPPPVKRVATKHQIPVY
QPEKLKDSQELDVLLSLESDLIVTAAFGQLLPESLLNAPKLGAINVHASLLPKYRGGAPI
HQAIIDGEEETGITIMYMVKKLDAGNIISQQSIRIEEEDNVGTMHDKLSFLGAELLKKTL
PSIIDNTNDSIPQDDALATFASNIRREDERIDWNMSAQAIHNHIRGLSPWPVAYTTMNEK
NLKLFSAFIVKGKKGNPGTIIEATKHELIIATGSDDAIALTEIQPAGKKRMKVTDYLSGV
QESLVGKVLL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcatttttatgggaacacctgatttttcaacgaaagttttagagatgtta
attgctgagcatgaagttatcgctgtagtgacacaacctgatagaccagtaggacgtaag
aaagtgatgacaccaccaccagtaaaaagagtagctacaaagcatcaaataccggtatac
cagcctgaaaaacttaaagattctcaagaattagacgtgttactttctttagaatcagat
ttaatagtaacggctgcgttcggtcaactattaccagagtccttactcaatgcacctaaa
ttaggagctattaacgtccatgcatcattgttacctaagtatagaggaggagcacctata
catcaggctatcattgatggtgaggaagaaactggaatcacgattatgtatatggttaaa
aaacttgatgcaggtaatatcatctcgcaacaatcaattcgtattgaagaagaagataat
gttggtacaatgcatgataaattaagctttttaggtgccgaattattaaagaagacactt
cctagtatcattgataataccaatgacagcatcccccaagatgatgcacttgcaacattt
gcatctaatattcgtcgtgaagacgagagaattgattggaatatgagtgcacaagcaatt
cataaccatattagaggactatctccttggccagtagcttatacaactatgaacgaaaag
aatctcaaattatttagcgctttcattgtgaaagggaaaaaaggtaatccaggaacaatt
attgaagctactaagcatgaactcatcatagctactggttctgatgatgcgatcgcactt
actgagattcaacctgcaggaaaaaaacgcatgaaagttactgattatttaagtggtgta
caagagtcgttagttgggaaagttctattatga

DBGET integrated database retrieval system