KEGG   Staphylococcus epidermidis RP62A: SERP0793Help
Entry
SERP0793          CDS       T00229                                 

Gene name
recG
Definition
ATP-dependent DNA helicase RecG (EC:3.6.1.-)
Orthology
K03655  
ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ser00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SERP0793 (recG)
Enzymes [BR:ser01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SERP0793 (recG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
792673..794721
Genome map
AA seq 682 aa AA seqDB search
MSKVHLIESPYALDKIKGIGPKRLALLEELNIKSVEDLVLYLPTRYEDNTVIDLNQADDQ
ATVTVQGEVYSSPTVAFFGRNKSKLTVHLMINHIAVKCVFFNQPYLKKKLELNSIVTIKG
KWNRNKQEINGNRIFFNDQKNQEDAHLEPVYRVKEGIKQKQLRDNIRQALSDVTIHEWLT
DDLREKYKLETLAYTIQTLHHPIDKQNLLRARRTYAFTELFMFELRMQWLNRLEKTSDEA
IEINYDINKVKQFIDSLPFELTDAQKVSVNEIFRDLKAPIRMHRLLQGDVGSGKTIVAAI
CMYALKTAGYQSALMVPTEILAEQHAESLMQLFGNTMNVALLTGSVKGKKRRLLLEQLEN
GTIDCLIGTHALIQDDVVFNNVGLVITDEQHRFGVNQRQILREKGAMTNVLFMTATPIPR
TLAISVFGEMDVSSIKQLPKGRKPIKTSWAKHEQYDQVLAQMSNELKKGRQAYVICPLIE
SSEHLEDVQNVVELYESLQSDYGNEKVGLLHGKMTAEDKDQVMQKFSEHEIDILVSTTVV
EVGVNVPNATFMMIYDADRFGLSTLHQLRGRVGRSEHQSYCVLIASPKTETGIERMTIMT
QTTDGFELSERDLEMRGPGDFFGVKQSGLPDFLVANVVEDYRMLEVARDEAAELIQSGQF
FEQQYSHLREFIKQNLRHIRFD
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagttcatcttattgagagcccgtatgcattagataaaattaaaggtataggt
ccaaaacgtttagcgttgttagaagaattaaatattaaatcagttgaagatttagtatta
tacttaccgacacgttatgaagataatactgttattgatttaaatcaagcagacgatcaa
gcaactgtaacagttcaaggtgaggtttattccagtccaactgttgctttttttggtcgt
aataaatcgaaattaactgtccatcttatgataaatcatatcgctgttaaatgcgtattt
tttaatcaaccatatttaaaaaagaaacttgaactaaatagtattgtcactataaaaggg
aaatggaatcgtaataaacaagagattaatggtaatcgtattttttttaatgatcaaaaa
aatcaagaggatgcccatttagaaccagtatatcgagttaaagaaggaataaaacaaaag
cagttacgagataacattagacaggcacttagtgatgttacaattcatgaatggttgact
gatgacctcagagaaaagtataaattagaaactttagcatatacaattcaaacattacat
catcctattgataaacaaaacttgctaagagctagacgaacttatgcatttacagagcta
tttatgtttgagctacgtatgcaatggttaaatcgcttagaaaagacatcagatgaagct
attgaaattaattacgatataaataaagtaaaacaatttattgatagtttgccatttgag
ttaactgatgctcaaaaagttagtgtcaatgaaatatttcgtgatttaaaggcgcctatt
cgtatgcatcggttgttacaaggtgatgttggatccggcaaaactatagtagcagcaatt
tgtatgtacgccttaaaaactgcaggatatcaatctgcattaatggttccaacggagatt
ttagctgaacagcacgctgaaagtttgatgcaactatttggtaatacaatgaacgtagct
ttattaactggttctgttaaagggaaaaaaagacgacttcttctagaacaattagaaaat
ggaactatcgattgtttgattggtacacacgccttgatacaagatgatgttgtcttcaat
aatgttggattagtcattacagatgaacagcaccgatttggtgttaaccaacgacaaatt
ctaagagaaaaaggtgcgatgaccaatgtgttgtttatgacagcgacaccaatccctaga
acactcgctatttctgttttcggtgaaatggatgtatcttcaattaaacaattaccaaaa
ggcagaaaacctataaaaacaagttgggcaaaacatgagcaatatgatcaagtacttgca
caaatgtcgaatgaattaaaaaagggtagacaagcctatgtgatctgtccattaattgaa
agctctgagcatttagaagatgtacaaaatgttgtggaactttatgaatccttacaaagt
gattacggtaatgaaaaagttggattattacatgggaaaatgactgctgaagataaagat
caagtcatgcaaaaattcagtgaacatgaaatagatattttagtttctactactgtagtt
gaggtgggtgtaaatgtacctaatgcaacgtttatgatgatttatgatgcagatcgattt
ggtttatctacattacatcaattacgtgggcgtgttggtcgtagtgaacatcaaagttat
tgtgtattaattgcatctcccaagactgaaacaggtattgaacgtatgaccattatgact
caaactactgatggattcgaattaagtgaaagagatttagaaatgagaggtccaggagat
ttctttggagtaaaacaaagcggtcttccagactttcttgtagcaaatgtagtagaagat
tatcgtatgcttgaagttgctagagatgaagcagcagaacttatacaatctggccaattt
ttcgaacaacaatatagtcatttaagagagtttattaaacaaaacttacgccacattcgt
tttgattag

DBGET integrated database retrieval system