KEGG   Staphylococcus epidermidis RP62A: SERP0793Help
Entry
SERP0793          CDS       T00229                                 

Gene name
recG
Definition
ATP-dependent DNA helicase RecG (EC:3.6.1.-)
Orthology
K03655  
ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ser03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
792673..794721
Genome map
AA seq 682 aa AA seqDB search
MSKVHLIESPYALDKIKGIGPKRLALLEELNIKSVEDLVLYLPTRYEDNTVIDLNQADDQ
ATVTVQGEVYSSPTVAFFGRNKSKLTVHLMINHIAVKCVFFNQPYLKKKLELNSIVTIKG
KWNRNKQEINGNRIFFNDQKNQEDAHLEPVYRVKEGIKQKQLRDNIRQALSDVTIHEWLT
DDLREKYKLETLAYTIQTLHHPIDKQNLLRARRTYAFTELFMFELRMQWLNRLEKTSDEA
IEINYDINKVKQFIDSLPFELTDAQKVSVNEIFRDLKAPIRMHRLLQGDVGSGKTIVAAI
CMYALKTAGYQSALMVPTEILAEQHAESLMQLFGNTMNVALLTGSVKGKKRRLLLEQLEN
GTIDCLIGTHALIQDDVVFNNVGLVITDEQHRFGVNQRQILREKGAMTNVLFMTATPIPR
TLAISVFGEMDVSSIKQLPKGRKPIKTSWAKHEQYDQVLAQMSNELKKGRQAYVICPLIE
SSEHLEDVQNVVELYESLQSDYGNEKVGLLHGKMTAEDKDQVMQKFSEHEIDILVSTTVV
EVGVNVPNATFMMIYDADRFGLSTLHQLRGRVGRSEHQSYCVLIASPKTETGIERMTIMT
QTTDGFELSERDLEMRGPGDFFGVKQSGLPDFLVANVVEDYRMLEVARDEAAELIQSGQF
FEQQYSHLREFIKQNLRHIRFD
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagttcatcttattgagagcccgtatgcattagataaaattaaaggtataggt
ccaaaacgtttagcgttgttagaagaattaaatattaaatcagttgaagatttagtatta
tacttaccgacacgttatgaagataatactgttattgatttaaatcaagcagacgatcaa
gcaactgtaacagttcaaggtgaggtttattccagtccaactgttgctttttttggtcgt
aataaatcgaaattaactgtccatcttatgataaatcatatcgctgttaaatgcgtattt
tttaatcaaccatatttaaaaaagaaacttgaactaaatagtattgtcactataaaaggg
aaatggaatcgtaataaacaagagattaatggtaatcgtattttttttaatgatcaaaaa
aatcaagaggatgcccatttagaaccagtatatcgagttaaagaaggaataaaacaaaag
cagttacgagataacattagacaggcacttagtgatgttacaattcatgaatggttgact
gatgacctcagagaaaagtataaattagaaactttagcatatacaattcaaacattacat
catcctattgataaacaaaacttgctaagagctagacgaacttatgcatttacagagcta
tttatgtttgagctacgtatgcaatggttaaatcgcttagaaaagacatcagatgaagct
attgaaattaattacgatataaataaagtaaaacaatttattgatagtttgccatttgag
ttaactgatgctcaaaaagttagtgtcaatgaaatatttcgtgatttaaaggcgcctatt
cgtatgcatcggttgttacaaggtgatgttggatccggcaaaactatagtagcagcaatt
tgtatgtacgccttaaaaactgcaggatatcaatctgcattaatggttccaacggagatt
ttagctgaacagcacgctgaaagtttgatgcaactatttggtaatacaatgaacgtagct
ttattaactggttctgttaaagggaaaaaaagacgacttcttctagaacaattagaaaat
ggaactatcgattgtttgattggtacacacgccttgatacaagatgatgttgtcttcaat
aatgttggattagtcattacagatgaacagcaccgatttggtgttaaccaacgacaaatt
ctaagagaaaaaggtgcgatgaccaatgtgttgtttatgacagcgacaccaatccctaga
acactcgctatttctgttttcggtgaaatggatgtatcttcaattaaacaattaccaaaa
ggcagaaaacctataaaaacaagttgggcaaaacatgagcaatatgatcaagtacttgca
caaatgtcgaatgaattaaaaaagggtagacaagcctatgtgatctgtccattaattgaa
agctctgagcatttagaagatgtacaaaatgttgtggaactttatgaatccttacaaagt
gattacggtaatgaaaaagttggattattacatgggaaaatgactgctgaagataaagat
caagtcatgcaaaaattcagtgaacatgaaatagatattttagtttctactactgtagtt
gaggtgggtgtaaatgtacctaatgcaacgtttatgatgatttatgatgcagatcgattt
ggtttatctacattacatcaattacgtgggcgtgttggtcgtagtgaacatcaaagttat
tgtgtattaattgcatctcccaagactgaaacaggtattgaacgtatgaccattatgact
caaactactgatggattcgaattaagtgaaagagatttagaaatgagaggtccaggagat
ttctttggagtaaaacaaagcggtcttccagactttcttgtagcaaatgtagtagaagat
tatcgtatgcttgaagttgctagagatgaagcagcagaacttatacaatctggccaattt
ttcgaacaacaatatagtcatttaagagagtttattaaacaaaacttacgccacattcgt
tttgattag

DBGET integrated database retrieval system