KEGG   Staphylococcus epidermidis RP62A: SERP0793Help
Entry
SERP0793          CDS       T00229                                 

Gene name
recG
Definition
(RefSeq) ATP-dependent DNA helicase RecG (EC:3.6.1.-)
  KO
K03655  
ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ser00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SERP0793 (recG)
Enzymes [BR:ser01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SERP0793 (recG)
DNA repair and recombination proteins [BR:ser03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     SERP0793 (recG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
792673..794721
Genome map
AA seq 682 aa AA seqDB search
MSKVHLIESPYALDKIKGIGPKRLALLEELNIKSVEDLVLYLPTRYEDNTVIDLNQADDQ
ATVTVQGEVYSSPTVAFFGRNKSKLTVHLMINHIAVKCVFFNQPYLKKKLELNSIVTIKG
KWNRNKQEINGNRIFFNDQKNQEDAHLEPVYRVKEGIKQKQLRDNIRQALSDVTIHEWLT
DDLREKYKLETLAYTIQTLHHPIDKQNLLRARRTYAFTELFMFELRMQWLNRLEKTSDEA
IEINYDINKVKQFIDSLPFELTDAQKVSVNEIFRDLKAPIRMHRLLQGDVGSGKTIVAAI
CMYALKTAGYQSALMVPTEILAEQHAESLMQLFGNTMNVALLTGSVKGKKRRLLLEQLEN
GTIDCLIGTHALIQDDVVFNNVGLVITDEQHRFGVNQRQILREKGAMTNVLFMTATPIPR
TLAISVFGEMDVSSIKQLPKGRKPIKTSWAKHEQYDQVLAQMSNELKKGRQAYVICPLIE
SSEHLEDVQNVVELYESLQSDYGNEKVGLLHGKMTAEDKDQVMQKFSEHEIDILVSTTVV
EVGVNVPNATFMMIYDADRFGLSTLHQLRGRVGRSEHQSYCVLIASPKTETGIERMTIMT
QTTDGFELSERDLEMRGPGDFFGVKQSGLPDFLVANVVEDYRMLEVARDEAAELIQSGQF
FEQQYSHLREFIKQNLRHIRFD
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagttcatcttattgagagcccgtatgcattagataaaattaaaggtataggt
ccaaaacgtttagcgttgttagaagaattaaatattaaatcagttgaagatttagtatta
tacttaccgacacgttatgaagataatactgttattgatttaaatcaagcagacgatcaa
gcaactgtaacagttcaaggtgaggtttattccagtccaactgttgctttttttggtcgt
aataaatcgaaattaactgtccatcttatgataaatcatatcgctgttaaatgcgtattt
tttaatcaaccatatttaaaaaagaaacttgaactaaatagtattgtcactataaaaggg
aaatggaatcgtaataaacaagagattaatggtaatcgtattttttttaatgatcaaaaa
aatcaagaggatgcccatttagaaccagtatatcgagttaaagaaggaataaaacaaaag
cagttacgagataacattagacaggcacttagtgatgttacaattcatgaatggttgact
gatgacctcagagaaaagtataaattagaaactttagcatatacaattcaaacattacat
catcctattgataaacaaaacttgctaagagctagacgaacttatgcatttacagagcta
tttatgtttgagctacgtatgcaatggttaaatcgcttagaaaagacatcagatgaagct
attgaaattaattacgatataaataaagtaaaacaatttattgatagtttgccatttgag
ttaactgatgctcaaaaagttagtgtcaatgaaatatttcgtgatttaaaggcgcctatt
cgtatgcatcggttgttacaaggtgatgttggatccggcaaaactatagtagcagcaatt
tgtatgtacgccttaaaaactgcaggatatcaatctgcattaatggttccaacggagatt
ttagctgaacagcacgctgaaagtttgatgcaactatttggtaatacaatgaacgtagct
ttattaactggttctgttaaagggaaaaaaagacgacttcttctagaacaattagaaaat
ggaactatcgattgtttgattggtacacacgccttgatacaagatgatgttgtcttcaat
aatgttggattagtcattacagatgaacagcaccgatttggtgttaaccaacgacaaatt
ctaagagaaaaaggtgcgatgaccaatgtgttgtttatgacagcgacaccaatccctaga
acactcgctatttctgttttcggtgaaatggatgtatcttcaattaaacaattaccaaaa
ggcagaaaacctataaaaacaagttgggcaaaacatgagcaatatgatcaagtacttgca
caaatgtcgaatgaattaaaaaagggtagacaagcctatgtgatctgtccattaattgaa
agctctgagcatttagaagatgtacaaaatgttgtggaactttatgaatccttacaaagt
gattacggtaatgaaaaagttggattattacatgggaaaatgactgctgaagataaagat
caagtcatgcaaaaattcagtgaacatgaaatagatattttagtttctactactgtagtt
gaggtgggtgtaaatgtacctaatgcaacgtttatgatgatttatgatgcagatcgattt
ggtttatctacattacatcaattacgtgggcgtgttggtcgtagtgaacatcaaagttat
tgtgtattaattgcatctcccaagactgaaacaggtattgaacgtatgaccattatgact
caaactactgatggattcgaattaagtgaaagagatttagaaatgagaggtccaggagat
ttctttggagtaaaacaaagcggtcttccagactttcttgtagcaaatgtagtagaagat
tatcgtatgcttgaagttgctagagatgaagcagcagaacttatacaatctggccaattt
ttcgaacaacaatatagtcatttaagagagtttattaaacaaaacttacgccacattcgt
tttgattag

DBGET integrated database retrieval system