KEGG   Staphylococcus epidermidis RP62A: SERP0811Help
Entry
SERP0811          CDS       T00229                                 

Gene name
rbgA
Definition
ribosomal biogenesis GTPase
Orthology
K14540  
ribosome biogenesis GTPase A
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
814088..814951
Genome map
AA seq 287 aa AA seqDB search
MAIQWYPGHMAKAKRQVSEQLKKVDVVFELVDARIPYSSRNPMIDDVIKQKPRVVILNKK
DMTNLKELEKWETYFKDEGFYPVAVDAKHGKNLKNVEVEAIKATQEKFDREKAKGLKPRA
IRAMIVGIPNVGKSTLINKLAKRSIAETGNKPGVTKQQQWIKVGKSLQLLDTPGILWPKF
EDEEVGKKLSLTGAIKDSIVHLDEVAIYGLNFMIKHDVSALKRHYNIDTHEDAEILDWFD
AIGRRRGLLQKGNEVDYESVIELIINDMRNAKIGTYCFDILKEMKSE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcgatacaatggtatccaggtcatatggctaaagccaaaagacaagttagtgaacaa
ctgaaaaaggtagatgtagtttttgaactcgtcgatgcacgtattccatacagttcgaga
aaccctatgattgatgatgtcattaaacaaaaacctcgagtagtaattttaaataaaaaa
gatatgacgaatttaaaagaattagaaaaatgggaaacttattttaaagatgaaggtttc
tatccggtagctgtagatgcaaaacatggcaagaatcttaaaaatgttgaagttgaagct
ataaaagcaactcaagaaaaatttgatcgtgaaaaagctaaaggtttaaaacctagagcg
ataagagctatgattgtaggcattcctaatgtaggaaaatcaacacttatcaataagtta
gcaaaacgtagtatcgccgaaactggaaataaaccaggagtaacaaaacagcaacaatgg
attaaagttggaaagtctcttcaattactagatacaccaggtattttatggcctaaattc
gaagatgaagaagtcggtaaaaaattaagtttaactggtgcaattaaggatagtatcgtt
catttagatgaggtagctatttatggtttgaattttatgattaaacatgatgtttcagct
ttaaagagacattataatattgatacacatgaagacgctgagatactcgattggtttgat
gcaattggaagaagaaggggattgttacaaaaaggaaatgaagtagattatgaatctgtc
attgagttgatcatcaatgatatgagaaatgcaaaaattggaacttattgttttgatatt
ttaaaagaaatgaagagtgaatga

DBGET integrated database retrieval system