KEGG   Staphylococcus epidermidis RP62A: SERP0818Help
Entry
SERP0818          CDS       T00229                                 

Gene name
xerC
Definition
tyrosine recombinase XerC
Orthology
K03733  
integrase/recombinase XerC
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
823416..824306
Genome map
AA seq 296 aa AA seqDB search
MDKIQETFLYMLKVERNFSEYTLKSYHDDLVQFNNFLEREHLQLETFEYKDARNYLAFLY
SNQLKRTTVSRKISTLRTFYEFWMTQDNSIINPFVQLVHPKKEKYLPQFFYEEEMEALFQ
TVEHDNKKGIRDKVIIELLYATGIRVSELINIKLKDIDMNLPGVKVLGKGNKERFIPFGE
FCRQSIERYLEEFQPKQLANHDYLIVNMKGDPITERGVRYVLNDVVKRTAGVNDIHPHKL
RHTFATHLLNQGADLRTVQSLLGHVNLSTTGRYTHVSNQQLRKVYLNAHPRAKKGE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttggataaaatccaagaaacatttttatatatgttaaaggttgaaagaaacttttcagag
tatacgttaaaatcttatcatgatgatttagttcaatttaacaactttttagaaagagaa
catttacaacttgagacttttgaatataaagatgctagaaactatttggcttttttatat
tctaatcaattaaaaagaactacggtgtcaagaaagatatcaactttacgtaccttctat
gaattttggatgactcaagataattcaattattaatccctttgttcaactagtgcatcct
aaaaaagagaagtatttacctcaattcttttatgaagaagaaatggaagcactttttcaa
actgtagagcatgataataaaaaaggcatacgagacaaagttattattgaattgttatat
gcaacaggaatacgtgtgtctgaattaataaatattaaactaaaagatatagatatgaac
ttaccaggtgtaaaagttttaggtaaaggaaataaggaaaggtttatcccttttggagag
ttctgtagacagagtatagaaagatacttagaagaattccaacctaaacaattagccaat
catgattatttaattgtaaatatgaaaggtgatcctatcaccgaaagaggagtaagatat
gtacttaatgatgtcgttaaaagaaccgctggcgtcaatgacatacatcctcataaatta
agacatacttttgctacacatttattaaatcaaggtgctgatttaaggactgtacaatct
ttacttggtcacgtcaatttatcgactactggacgttatacacatgtttcgaatcaacaa
ctgagaaaggtgtatttaaacgcacatcctcgagcaaaaaaaggagagtaa

DBGET integrated database retrieval system