KEGG   Staphylococcus epidermidis RP62A: SERP0842Help
Entry
SERP0842          CDS       T00229                                 

Definition
metallo-beta-lactamase
Orthology
K12574  
ribonuclease J [EC:3.1.-.-]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:ser00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SERP0842
Enzymes [BR:ser01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     SERP0842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
850644..852350
Genome map
AA seq 568 aa AA seqDB search
MDGSLFIGGNILSLIKKKNKDIRIIPLGGVGEIAKNMYIVEVDDEMFMLDAGLMFPEDEM
LGVDIVIPDIQYVIENKERLKGIFLTHGHEHAIGAVSYVLEQIDAPVYGSKLTIALVKEA
MKARNIKKKVRYYTVNHDSIMRFKNVNVSFFNTTHSIPDSLGVCIHTSYGSIVYTGEFKF
DQSLHGHYAPDLKRMAEIGDEGVFALISDSTEAEKPGYNTPENIIEHHMYDAFAKVKGRL
IVSCYASNFVRIQQVLNIASQLNRKVSFLGRSLESSFNIARKMGYFDIPKDLLIPINEVE
NYPKNEVIIIATGMQGEPVEALSQMARKKHKIMNIEEGDSIFLAITASANMEVIIADTLN
ELVRAGAHIIPNNKKIHASSHGCMEELKMMLNIMKPEYFVPVQGEFKMQIAHAKLAAETG
VAPEKIFLVEKGDVISYNGKDMILNEKVQSGNILIDGIGVGDVGNIVLRDRHLLAEDGIF
IAVVTLDPKNRRIAAGPEIQSRGFVYVRESEELLKEAEEKVRKIVEEGLQEKRIEWSEIK
QNMRDQISKLLFESTKRRPMIIPVISEI
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggacgggtcactatttataggaggtaacattttgagtttaataaagaaaaaaaataaa
gatattcgtattattccactcggtggagtaggcgaaatcgctaaaaatatgtacatcgtt
gaagtagacgatgaaatgtttatgttggatgcaggattaatgttcccagaagatgaaatg
cttggggtagatatcgttattcctgacattcaatatgtcattgaaaacaaagaaagatta
aaaggaatatttcttacacacggtcatgaacatgctataggcgcagtaagttatgtgtta
gaacaaatcgatgcaccagtttatggttctaaattgacaatcgcacttgttaaagaagca
atgaaggcccgaaatattaaaaagaaagtacgttactatactgtaaaccatgattcaatt
atgagatttaaaaatgttaacgtgagtttctttaatacgacacatagcattcctgatagc
ttaggcgtatgtattcatacttcgtatggttctatagtttatactggagagtttaagttt
gatcaaagtttgcatggacattatgctccagacttgaaacgtatggcagaaattggtgat
gagggtgtgttcgcattaatcagtgattcaacagaagctgaaaagcctggatataacacg
cctgaaaatattattgaacatcacatgtatgatgcttttgccaaggttaaaggtagactt
attgtatcatgctatgcttcaaacttcgttcgtattcaacaagtgcttaacattgcaagt
caacttaatcgtaaagtgtcatttttaggtcgttcacttgaaagttcgtttaacatagca
cgtaaaatgggatactttgatataccaaaagatttattaatacctattaacgaagtggaa
aattatcctaaaaatgaagtgattattattgctacaggtatgcaaggtgaaccagtagaa
gcattaagtcaaatggctcgcaaaaagcataaaattatgaacatagaagaaggagattca
atattcctagcaattactgcttcagctaatatggaggttattattgcagatacattaaat
gagttagtgcgtgctggagcacatataattccaaacaacaagaaaattcatgcgtcaagt
catggttgtatggaagaattgaaaatgatgttaaatattatgaaacctgaatattttgta
cctgttcaaggtgaatttaaaatgcagattgcacatgccaaattagcagcagaaaccggt
gtagcacctgagaaaattttcttagttgaaaaaggcgacgtgattagttataacggtaaa
gatatgattttaaatgaaaaagttcaatcaggtaatatacttattgatgggattggcgtt
ggtgacgtaggtaatatcgtattaagagacagacatctattagccgaagacggtattttt
attgcggttgtgacattagatcctaaaaatcgacgtattgctgcaggacctgaaattcaa
tcaagaggcttcgtctatgttagagaaagtgaagaacttttgaaagaggctgaagaaaaa
gtacgtaaaattgtagaggaaggtcttcaagaaaaacgaatagaatggtcagaaatcaag
caaaatatgagagatcaaatcagtaagttactatttgagagtacaaaacgccgtccaatg
attattccagtcatatcggagatctaa

DBGET integrated database retrieval system