KEGG   Staphylococcus epidermidis RP62A: SERP0842Help
Entry
SERP0842          CDS       T00229                                 

Definition
metallo-beta-lactamase
Orthology
K12574  
ribonuclease J [EC:3.1.-.-]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
RNA degradation
Class
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:ser03018]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
850644..852350
Genome map
AA seq 568 aa AA seqDB search
MDGSLFIGGNILSLIKKKNKDIRIIPLGGVGEIAKNMYIVEVDDEMFMLDAGLMFPEDEM
LGVDIVIPDIQYVIENKERLKGIFLTHGHEHAIGAVSYVLEQIDAPVYGSKLTIALVKEA
MKARNIKKKVRYYTVNHDSIMRFKNVNVSFFNTTHSIPDSLGVCIHTSYGSIVYTGEFKF
DQSLHGHYAPDLKRMAEIGDEGVFALISDSTEAEKPGYNTPENIIEHHMYDAFAKVKGRL
IVSCYASNFVRIQQVLNIASQLNRKVSFLGRSLESSFNIARKMGYFDIPKDLLIPINEVE
NYPKNEVIIIATGMQGEPVEALSQMARKKHKIMNIEEGDSIFLAITASANMEVIIADTLN
ELVRAGAHIIPNNKKIHASSHGCMEELKMMLNIMKPEYFVPVQGEFKMQIAHAKLAAETG
VAPEKIFLVEKGDVISYNGKDMILNEKVQSGNILIDGIGVGDVGNIVLRDRHLLAEDGIF
IAVVTLDPKNRRIAAGPEIQSRGFVYVRESEELLKEAEEKVRKIVEEGLQEKRIEWSEIK
QNMRDQISKLLFESTKRRPMIIPVISEI
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggacgggtcactatttataggaggtaacattttgagtttaataaagaaaaaaaataaa
gatattcgtattattccactcggtggagtaggcgaaatcgctaaaaatatgtacatcgtt
gaagtagacgatgaaatgtttatgttggatgcaggattaatgttcccagaagatgaaatg
cttggggtagatatcgttattcctgacattcaatatgtcattgaaaacaaagaaagatta
aaaggaatatttcttacacacggtcatgaacatgctataggcgcagtaagttatgtgtta
gaacaaatcgatgcaccagtttatggttctaaattgacaatcgcacttgttaaagaagca
atgaaggcccgaaatattaaaaagaaagtacgttactatactgtaaaccatgattcaatt
atgagatttaaaaatgttaacgtgagtttctttaatacgacacatagcattcctgatagc
ttaggcgtatgtattcatacttcgtatggttctatagtttatactggagagtttaagttt
gatcaaagtttgcatggacattatgctccagacttgaaacgtatggcagaaattggtgat
gagggtgtgttcgcattaatcagtgattcaacagaagctgaaaagcctggatataacacg
cctgaaaatattattgaacatcacatgtatgatgcttttgccaaggttaaaggtagactt
attgtatcatgctatgcttcaaacttcgttcgtattcaacaagtgcttaacattgcaagt
caacttaatcgtaaagtgtcatttttaggtcgttcacttgaaagttcgtttaacatagca
cgtaaaatgggatactttgatataccaaaagatttattaatacctattaacgaagtggaa
aattatcctaaaaatgaagtgattattattgctacaggtatgcaaggtgaaccagtagaa
gcattaagtcaaatggctcgcaaaaagcataaaattatgaacatagaagaaggagattca
atattcctagcaattactgcttcagctaatatggaggttattattgcagatacattaaat
gagttagtgcgtgctggagcacatataattccaaacaacaagaaaattcatgcgtcaagt
catggttgtatggaagaattgaaaatgatgttaaatattatgaaacctgaatattttgta
cctgttcaaggtgaatttaaaatgcagattgcacatgccaaattagcagcagaaaccggt
gtagcacctgagaaaattttcttagttgaaaaaggcgacgtgattagttataacggtaaa
gatatgattttaaatgaaaaagttcaatcaggtaatatacttattgatgggattggcgtt
ggtgacgtaggtaatatcgtattaagagacagacatctattagccgaagacggtattttt
attgcggttgtgacattagatcctaaaaatcgacgtattgctgcaggacctgaaattcaa
tcaagaggcttcgtctatgttagagaaagtgaagaacttttgaaagaggctgaagaaaaa
gtacgtaaaattgtagaggaaggtcttcaagaaaaacgaatagaatggtcagaaatcaag
caaaatatgagagatcaaatcagtaagttactatttgagagtacaaaacgccgtccaatg
attattccagtcatatcggagatctaa

DBGET integrated database retrieval system