KEGG   Staphylococcus epidermidis RP62A: SERP0860Help
Entry
SERP0860          CDS       T00229                                 

Gene name
miaB
Definition
(dimethylallyl)adenosine tRNA methylthiotransferase
Orthology
K06168  
tRNA-2-methylthio-N6-dimethylallyladenosine synthase [EC:2.8.4.3]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.3  tRNA-2-methylthio-N6-dimethylallyladenosine synthase
     SERP0860 (miaB)
Transfer RNA biogenesis [BR:ser03016]
 Prokaryotic Type
  tRNA modification factors
   Methylthiotransferase
    SERP0860 (miaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
871516..873060
Genome map
AA seq 514 aa AA seqDB search
MNEEQRKAGTINILAERDRKAEKDYSKYFEQVYQPPSLKEAKKRGKQEVQYNRDFHIDEK
YKGMGKGRTFLIKTYGCQMNAHDTEVMAGILNALGYSATSDINEADVILINTCAIRENAE
NKVFSEIGNLKHLKKERPDCLIGVCGCMSQEESVVNKILKSYQNVDMVFGTHNIHHLPEI
LEEAYLSKAMVVEVWSKEGDIIENLPKVRDGHIKAWVNIMYGCDKFCTYCIVPFTRGKER
SRRPEDIIDEVRELAREGYQEITLLGQNVNSYGKDIEGLDYELGDLLEDISKIDIPRVRF
TTSHPWDFTDRMIEVIAKGGNIVPHIHLPVQSGNNQVLKIMGRKYTRESYLDLVSRIKEA
IPNVALTTDIIVGYPNETEEQFEETLSLYDDVQFEHAYTYLYSQRDGTPAAKMKDNVPLE
VKKERLQRLNKKVGIYSQQAMSQYEGKIVTVLCEGSSKKDENVLAGYTDKNKLVNFKGPR
ESIGKLVDVKIDEAKQYSLNGTFIQEHQRSMVTQ
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaagagcaaagaaaggctggaacgataaatattctagctgaacgtgatcgtaaa
gctgagaaagattatagtaaatactttgaacaagtgtatcagccacctagcttaaaagaa
gctaaaaaaagaggaaaacaagaagttcaatataacagagattttcatatagatgaaaaa
tacaaaggtatgggtaaaggtcgcacttttttaattaaaacatatggatgtcaaatgaat
gcacatgacactgaagttatggcaggaatattaaatgcattaggatatagtgctacttcg
gatattaatgaagcggatgtgattttaattaatacatgcgccattagagaaaatgctgaa
aataaagtctttagtgaaataggaaatttaaaacatttaaaaaaagaacgcccagattgt
ttaattggggtgtgtggttgcatgtctcaagaagaatcagtcgtaaataaaatattaaaa
tcttatcaaaatgtagatatggtttttgggacacacaacattcatcatttacctgagatt
ttagaagaggcatatttatctaaagcgatggtagttgaagtatggtctaaagagggagac
atcatcgaaaatttacctaaagtgcgtgacggtcacattaaagcttgggttaatattatg
tatggttgcgataagttttgtacttattgtattgttccatttactagaggaaaagaacgt
agtcgtcgtccagaggacatcattgatgaggttagagaattagcaagagaaggttatcaa
gaaattaccttattaggtcaaaatgtaaattcatatggtaaagatatcgaaggtctggat
tatgaattaggtgacttattggaagatatttctaaaattgatatacctcgtgttcgtttt
acaacaagtcatccttgggactttacagatcgaatgattgaagttatagctaaaggtggg
aacatagtaccgcatatccatttgccggtacaatcaggtaataaccaagtattaaagata
atggggcgtaaatatacaagagagagttatcttgatttagtttcaagaataaaggaagct
atccctaacgtagctctaactactgatatcatagtaggttatccaaatgaaactgaagaa
caatttgaagaaacattatcattatatgatgacgttcaatttgagcatgcatacacatat
ttatattcacaaagagatggaacaccagcagctaaaatgaaggataacgtacctttagaa
gtgaaaaaagaacgtttgcaaaggcttaataagaaggttggaatatattctcaacaagca
atgagtcagtatgaaggtaagattgttacggtattatgtgaaggttctagtaaaaaagat
gagaatgttctagcaggctatactgataaaaataaacttgtgaattttaaaggaccaaga
gagagcattggtaaactcgttgatgtcaaaattgacgaggcaaaacaatattctttaaat
ggaacatttatacaagaacatcaacgttcaatggtgacacaataa

DBGET integrated database retrieval system