KEGG   Staphylococcus epidermidis RP62A: SERP0860Help
Entry
SERP0860          CDS       T00229                                 

Gene name
miaB
Definition
(dimethylallyl)adenosine tRNA methylthiotransferase
Orthology
K06168  
bifunctional enzyme involved in thiolation and methylation of tRNA
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Transfer RNA biogenesis [BR:ser03016]
 Prokaryotic Type
  tRNA modification factors
   Methylthiotransferase
    SERP0860 (miaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
871516..873060
Genome map
AA seq 514 aa AA seqDB search
MNEEQRKAGTINILAERDRKAEKDYSKYFEQVYQPPSLKEAKKRGKQEVQYNRDFHIDEK
YKGMGKGRTFLIKTYGCQMNAHDTEVMAGILNALGYSATSDINEADVILINTCAIRENAE
NKVFSEIGNLKHLKKERPDCLIGVCGCMSQEESVVNKILKSYQNVDMVFGTHNIHHLPEI
LEEAYLSKAMVVEVWSKEGDIIENLPKVRDGHIKAWVNIMYGCDKFCTYCIVPFTRGKER
SRRPEDIIDEVRELAREGYQEITLLGQNVNSYGKDIEGLDYELGDLLEDISKIDIPRVRF
TTSHPWDFTDRMIEVIAKGGNIVPHIHLPVQSGNNQVLKIMGRKYTRESYLDLVSRIKEA
IPNVALTTDIIVGYPNETEEQFEETLSLYDDVQFEHAYTYLYSQRDGTPAAKMKDNVPLE
VKKERLQRLNKKVGIYSQQAMSQYEGKIVTVLCEGSSKKDENVLAGYTDKNKLVNFKGPR
ESIGKLVDVKIDEAKQYSLNGTFIQEHQRSMVTQ
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaagagcaaagaaaggctggaacgataaatattctagctgaacgtgatcgtaaa
gctgagaaagattatagtaaatactttgaacaagtgtatcagccacctagcttaaaagaa
gctaaaaaaagaggaaaacaagaagttcaatataacagagattttcatatagatgaaaaa
tacaaaggtatgggtaaaggtcgcacttttttaattaaaacatatggatgtcaaatgaat
gcacatgacactgaagttatggcaggaatattaaatgcattaggatatagtgctacttcg
gatattaatgaagcggatgtgattttaattaatacatgcgccattagagaaaatgctgaa
aataaagtctttagtgaaataggaaatttaaaacatttaaaaaaagaacgcccagattgt
ttaattggggtgtgtggttgcatgtctcaagaagaatcagtcgtaaataaaatattaaaa
tcttatcaaaatgtagatatggtttttgggacacacaacattcatcatttacctgagatt
ttagaagaggcatatttatctaaagcgatggtagttgaagtatggtctaaagagggagac
atcatcgaaaatttacctaaagtgcgtgacggtcacattaaagcttgggttaatattatg
tatggttgcgataagttttgtacttattgtattgttccatttactagaggaaaagaacgt
agtcgtcgtccagaggacatcattgatgaggttagagaattagcaagagaaggttatcaa
gaaattaccttattaggtcaaaatgtaaattcatatggtaaagatatcgaaggtctggat
tatgaattaggtgacttattggaagatatttctaaaattgatatacctcgtgttcgtttt
acaacaagtcatccttgggactttacagatcgaatgattgaagttatagctaaaggtggg
aacatagtaccgcatatccatttgccggtacaatcaggtaataaccaagtattaaagata
atggggcgtaaatatacaagagagagttatcttgatttagtttcaagaataaaggaagct
atccctaacgtagctctaactactgatatcatagtaggttatccaaatgaaactgaagaa
caatttgaagaaacattatcattatatgatgacgttcaatttgagcatgcatacacatat
ttatattcacaaagagatggaacaccagcagctaaaatgaaggataacgtacctttagaa
gtgaaaaaagaacgtttgcaaaggcttaataagaaggttggaatatattctcaacaagca
atgagtcagtatgaaggtaagattgttacggtattatgtgaaggttctagtaaaaaagat
gagaatgttctagcaggctatactgataaaaataaacttgtgaattttaaaggaccaaga
gagagcattggtaaactcgttgatgtcaaaattgacgaggcaaaacaatattctttaaat
ggaacatttatacaagaacatcaacgttcaatggtgacacaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system