KEGG   Staphylococcus epidermidis RP62A: SERP0869Help
Entry
SERP0869          CDS       T00229                                 

Definition
alpha/beta hydrolase
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
884189..885115
Genome map
AA seq 308 aa AA seqDB search
MSQSHFKITVEDGTMLEVKIDKAKKSTIGIVHLFHGMAEHMDRYQELVEALNTQGYDVVR
HNHRGHGKEIDENERGHFNSMNQIVDDAYEIIETLYLEELNVPYIIIGHSMGSIIARSFV
EKYPDIAQGLILTGTGMFPKWKGVPIRLAMKLVTFIFGKRRRLKWVNQLLNKTFNKKITQ
PRTDSDWISTRQDEVDKFVEDEFCGFKVSNQLIYQTLKTMMKTVERQQLKRMDKELPILF
ISGKDDPFGEYGKGIKHLARLYKRVGIKHITVQLYKHKRHEILFEEDYLKTWQHMFEWME
KQILKKQK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcaaagtcattttaaaataacagttgaagatggaacaatgttagaggtgaaaatt
gataaagcaaaaaagagtactattggtattgttcatcttttccatggcatggctgaacat
atggaccgttatcaagagttagttgaggctttaaatacacaaggttatgacgttgttaga
cataatcaccgtggacatggtaaagaaatagatgagaatgaacgtggtcattttaatagc
atgaatcaaattgtagatgatgcttatgaaattattgagacattatatcttgaagagctc
aatgtaccctatattatcataggtcattcaatgggctccattattgctagatcatttgtt
gaaaagtatcctgacattgctcaaggtttaattcttacaggaacaggtatgttccccaag
tggaaaggtgtaccaatacgtttagcaatgaagttagttacatttatttttgggaaacga
cgtcgactcaagtgggtgaatcaattattgaataaaactttcaataaaaaaatcactcaa
cctcgaacagatagtgattggatttctacacgtcaggatgaagttgataaatttgtggaa
gatgaattttgtggattcaaagtatctaatcagctcatttatcaaactttaaagaccatg
atgaagacagtagaacgacaacaactaaaaagaatggacaaagaactacctatactattt
atttctgggaaagatgatccttttggtgaatatggtaaaggtataaagcatttagctaga
ttatataaaagagtaggtattaaacatataacagtacaactatataaacataagcgtcat
gaaatattatttgaagaagattatttgaaaacatggcaacacatgtttgaatggatggaa
aagcaaattttgaaaaaacaaaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system