KEGG   Staphylococcus epidermidis RP62A: SERP0869Help
Entry
SERP0869          CDS       T00229                                 

Definition
(GenBank) hydrolase, alpha/beta hydrolase fold family
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 LIDHydrolase Abhydrolase_6 Thioesterase Peptidase_S9 PGAP1 Abhydrolase_5 Peptidase_S28 Ndr Acyl_transf_2 MutS_III
Motif
Other DBs
NCBI-ProteinID: AAW54268
UniProt: Q5HPN9
Position
884189..885115
Genome map
AA seq 308 aa AA seqDB search
MSQSHFKITVEDGTMLEVKIDKAKKSTIGIVHLFHGMAEHMDRYQELVEALNTQGYDVVR
HNHRGHGKEIDENERGHFNSMNQIVDDAYEIIETLYLEELNVPYIIIGHSMGSIIARSFV
EKYPDIAQGLILTGTGMFPKWKGVPIRLAMKLVTFIFGKRRRLKWVNQLLNKTFNKKITQ
PRTDSDWISTRQDEVDKFVEDEFCGFKVSNQLIYQTLKTMMKTVERQQLKRMDKELPILF
ISGKDDPFGEYGKGIKHLARLYKRVGIKHITVQLYKHKRHEILFEEDYLKTWQHMFEWME
KQILKKQK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcaaagtcattttaaaataacagttgaagatggaacaatgttagaggtgaaaatt
gataaagcaaaaaagagtactattggtattgttcatcttttccatggcatggctgaacat
atggaccgttatcaagagttagttgaggctttaaatacacaaggttatgacgttgttaga
cataatcaccgtggacatggtaaagaaatagatgagaatgaacgtggtcattttaatagc
atgaatcaaattgtagatgatgcttatgaaattattgagacattatatcttgaagagctc
aatgtaccctatattatcataggtcattcaatgggctccattattgctagatcatttgtt
gaaaagtatcctgacattgctcaaggtttaattcttacaggaacaggtatgttccccaag
tggaaaggtgtaccaatacgtttagcaatgaagttagttacatttatttttgggaaacga
cgtcgactcaagtgggtgaatcaattattgaataaaactttcaataaaaaaatcactcaa
cctcgaacagatagtgattggatttctacacgtcaggatgaagttgataaatttgtggaa
gatgaattttgtggattcaaagtatctaatcagctcatttatcaaactttaaagaccatg
atgaagacagtagaacgacaacaactaaaaagaatggacaaagaactacctatactattt
atttctgggaaagatgatccttttggtgaatatggtaaaggtataaagcatttagctaga
ttatataaaagagtaggtattaaacatataacagtacaactatataaacataagcgtcat
gaaatattatttgaagaagattatttgaaaacatggcaacacatgtttgaatggatggaa
aagcaaattttgaaaaaacaaaagtga

DBGET integrated database retrieval system