KEGG   Staphylococcus epidermidis RP62A: SERP0889Help
Entry
SERP0889          CDS       T00229                                 

Definition
LuxR family transcriptional regulator
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
901943..902545
Genome map
AA seq 200 aa AA seqDB search
MISLVITEDQLMLRKAMVQLIEMHEEMNVLKDFENGLETLEFIENNEPNVAILDIEIPGI
TGLEILSYVRKKQLNTRIIIVTTFKRPGYFEKAVANDVDAYVLKERSIDDLIKTIYKVTK
GEKEYSPSLMTSLFTESNPLTHKEQVVLREIGNGLSSKEIASKLYLSNGTVRNYTSTIID
KMNSDHRFEAWKKANEKGWI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatatcgcttgtcataactgaggatcaattgatgttaagaaaagctatggtacaactg
atagaaatgcatgaagaaatgaatgtattaaaagattttgaaaatggtctagagacactc
gaatttattgaaaataatgaacccaatgtagccattttagatattgaaattccgggtata
acaggcttggaaatcttatcttatgtaagaaaaaaacaactcaatacaagaataatcata
gtgactacatttaaacgtccaggttattttgaaaaagctgtagcaaatgatgttgatgct
tatgtactaaaagagcgttcaattgatgatttaattaaaactatttataaagtgacaaag
ggtgagaaggaatatagcccttcactcatgacatcattgtttaccgaatcgaatccatta
actcataaagaacaagttgttttaagagaaataggcaatgggttaagtagcaaagagatt
gctagcaaattgtatttatcgaacgggactgtgcgtaactatacgagtactattatagac
aaaatgaattcagatcatcgttttgaggcatggaaaaaagcaaatgaaaaggggtggatt
taa

DBGET integrated database retrieval system