KEGG   Staphylococcus epidermidis RP62A: SERP0891Help
Entry
SERP0891          CDS       T00229                                 

Definition
thermonuclease precursor family protein
Orthology
K01174  
micrococcal nuclease [EC:3.1.31.1]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.31  Endoribonucleases that are active with either ribo- or deoxyribonucleic acids and produce 3'-phosphomonoesters
    3.1.31.1  micrococcal nuclease
     SERP0891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
903067..903603
Genome map
AA seq 178 aa AA seqDB search
MKSKKMSSLLVVAMIGIIVIIFQFVNHSGPFSGSESQHQSDNSNLNGKDKVYVKRVVDGD
TFVAQKNGEEIKVRLIGVDTPETVKPNTPVQPYGKQASNYTKKYLTHQNVYLEYDKEKTD
RYGRTLAYVWLKNGDMLNESLVKKGLAREKYFSPNGKYRNTFVNAQEEAKKRKLNIWS
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatctaagaaaatgtcatcgcttttagtagtagcgatgataggaataattgtaatt
attttccagtttgtaaaccattctggaccgtttagtggttcagaatctcaacatcaatca
gataattccaatttaaatggtaaagacaaagtatatgtgaaacgagttgtagatggtgat
acatttgttgctcaaaaaaatggagaggaaattaaagttagattaattggtgtagataca
ccagaaactgttaagcctaatacgccagttcaaccatatggtaaacaagcatctaattat
acgaagaagtatctcacgcatcaaaatgtttatttagaatatgataaagaaaaaactgat
aggtatggtcgtactttggcgtacgtatggttaaaaaatggagatatgcttaacgaatcg
ctggtgaaaaaaggtttagccagagaaaagtatttttctccaaatggaaaatatagaaat
accttcgtaaatgctcaagaggaagcaaaaaagagaaaattaaatatttggagctag

DBGET integrated database retrieval system