KEGG   Staphylococcus epidermidis RP62A: SERP0907Help
Entry
SERP0907          CDS       T00229                                 

Definition
hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
917887..918912
Genome map
AA seq 341 aa AA seqDB search
MNTIKRFLLLITVLLCIVIFTPVKETTFMIKAQNDIRHQINRWIDSDSNDDNTQLAIPKK
QEFAINNIQMNMTKKDVEAQLGQHKRMTSSVYGTNWYTYYSNDYNQFLMVSYINNHVNAL
YTNQNLISSKSQIKYDTPKDVVRERYGPPIQVIKKGKVGFDVKSNEYDVFHKDHIYTTVF
YDKHRDNGVKSLLQVSEKMENRLRYQYGKPSKLLAKSFELQNFDIVNAERKQHGLKTLDY
SKDVSHTARKHSVDMVKHNYFDHVNQKKLSPFDRLKKDGIEFNAAGENLAYGQLNSIYAH
EGLMNSLGHRKNILNTHFDYLGVGVYFNDRRQPFWTENYTS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacaattaaaagatttcttttattgattacagttttactttgcatcgttattttt
acgccagtcaaagaaactacttttatgattaaagctcaaaatgatatacgtcatcaaatt
aatcgatggattgattctgattcaaatgacgataatactcaattagcgattcctaaaaag
caagaatttgcaatcaacaatatacagatgaatatgactaaaaaagatgttgaagcacaa
ttgggacaacataagcgtatgacttcgagtgtgtatggcacaaattggtacacatattat
tcaaatgattataatcaatttttgatggtgagttatattaacaatcatgttaatgcactg
tatacaaatcaaaatcttatttcatcaaaatctcaaattaagtatgatactcctaaagat
gttgttagggaaagatatgggcccccgattcaagttataaaaaaagggaaagttggtttt
gatgtaaaaagtaatgaatatgatgttttccataaagaccatatttataccacagtattt
tatgataagcacagagataatggtgtgaagtcattattacaagttagtgagaaaatggaa
aatcgattaagatatcaatatgggaaaccatctaaattacttgcaaagagttttgagttg
caaaattttgacattgtcaatgctgaaagaaaacagcatggcttaaaaacattagattat
tctaaggatgtttctcatactgcgcgtaagcatagtgttgacatggttaagcataattat
tttgaccatgtaaatcaaaagaaactttctccttttgatagattaaaaaaagatggaata
gaatttaatgctgctggagaaaacttagcatatggacaattgaatagtatctatgcacat
gaaggtttgatgaattcattggggcatagaaagaatattttaaacacccattttgattat
ttgggcgtaggtgtatatttcaatgatcgaagacaacccttttggaccgaaaattataca
agttaa

DBGET integrated database retrieval system