KEGG   Staphylococcus epidermidis RP62A: SERP0926Help
Entry
SERP0926          CDS       T00229                                 

Gene name
parC
Definition
DNA topoisomerase IV subunit A (EC:5.99.1.-)
Orthology
K02621  
topoisomerase IV subunit A [EC:5.99.1.-]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.-  
     SERP0926 (parC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
939046..941448
Genome map
AA seq 800 aa AA seqDB search
MSEIIQDLSLEDVIGDRFGRYSKYIIQERALPDVRDGLKPVQRRILFAMYSSGNTYDKNF
RKSAKTVGDVIGQYHPHGDSSVYDAMVRLSQDWKLRHVLIEMHGNNGSIDNDPPAAMRYT
EAKLSQLSEELLRDINKETVSFIPNYDDTTLEPMVLPARFPNLLINGSTGISSGYATDIP
PHNLAEVIQGTLKYIDQPDITINQLMKYIKGPDFPTGGIIQGIEGIKKAYETGKGKVVVR
SRVDEEPLRSGRKQLIVTEIPYEVNKSSLVKRIDELRADKKVDGIVEVRDETDRTGLRIA
IELKKDANSESIKNYLYKNSDLQISYNFNMVAISEGRPKLMGLREIIESYLNHQIEVVTN
RTRYDLEQAEKRMHIVEGLMKALSILDEVIALIRNSKNKKDAKDNLVAEYDFTEAQAEAI
VMLQLYRLTNTDIEALKKEHEELEALIKELRNILDNHEALLAVIKDELNEIKKKFKVDRL
STIEAEISEIKIDKEVMVPSEEVILSLTQHGYIKRTSTRSFNASGVTEIGLKDGDRLLKH
ESVNTQDTVLVFTNKGRYLFIPVHKLADIRWKELGQHISQIVPIDEDEEVVNVYNEKDFK
NEAFYIMATKNGMIKKSSASQFKTTRFNKPLINMKVKDKDELINVVRLESDQLITVLTHK
GMSLTYSTNELSDTGLRAAGVKSINLKDEDYVVMTEDVNDSDSIIMVTQRGAMKRIDFNV
LQEAKRAQRGITLLKELKKKPHRIVAGAVVKENHTKYIVFSQHHEEYGNIDDVHLSEQYT
NGSFIIDTDDFGEVESMILE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgagataattcaagatttgtcacttgaagatgttattggtgaccgatttggacgt
tatagtaaatatatcattcaagaacgtgcattacctgatgtacgtgatggtttaaaacca
gtacaacgacgtatactattcgcaatgtattcaagtgggaatacgtatgataaaaatttc
cgtaaaagtgcgaaaactgtcggtgatgtaataggtcaatatcatcctcatggagactct
tcagtatatgatgctatggtgcgcttaagtcaagattggaagttacgtcatgttctaatt
gaaatgcatggtaataatggtagtatcgataacgatcctccagctgctatgcgttacaca
gaagctaaacttagtcaattatcagaagaactattaagggatattaataaggaaacagta
tcatttattccaaactatgatgacacaactttggaaccaatggtattaccagcgagattt
cctaatttattaattaatggatctacggggatttcttcaggatatgctactgatatcccg
ccgcataacctcgccgaagtaatacaaggcacattgaagtatatcgatcaacctgatatt
acaattaatcaactgatgaaatatatcaaagggcctgactttcctacaggtggtatcatt
caaggaatagaaggtataaaaaaagcgtatgagaccggtaaaggaaaggttgtcgtgcgt
tcacgagtagatgaagagcctttaagaagtggacgtaaacaattaattgtgactgaaatt
ccgtatgaagtgaataaaagtagtttagttaaaagaattgacgaattacgtgccgataaa
aaggttgatggtattgtagaagttcgagatgagactgatagaactggattacgaattgca
atcgaattaaaaaaagatgctaatagcgaatcaatcaaaaactatttatataagaattcg
gatttacaaatttcatataattttaatatggttgctattagtgaaggtcgccctaagttg
atgggattacgtgaaattatagaaagttatttaaatcatcaaattgaagtggttacaaat
agaacgcgttatgacttagagcaagctgaaaaacgtatgcatattgtggaaggattaatg
aaagctttatctatacttgatgaagttattgcattgatacgtaattctaaaaataaaaaa
gatgctaaagataatttagttgcagagtatgactttactgaagctcaagcagaagctatt
gtcatgttacagctgtatagattaacaaatactgacattgaagctttgaaaaaagaacat
gaagagttagaagctttaataaaagaattaagaaatatcttagataatcatgaggcactt
ttagcagtaattaaagatgaactaaatgaaattaaaaagaaatttaaagtggatcgacta
tctacaatcgaagctgaaatttccgaaatcaaaattgataaagaagttatggtgcctagt
gaagaagtgattttaagtttgacgcaacatggctatataaaacgtacatctacacgtagt
tttaacgcaagtggtgtgactgaaatcggtttgaaggacggcgaccgtttattaaaacat
gaaagcgtgaatactcaagatactgttcttgtatttacaaataaaggtagatatttgttt
atacctgttcataaattagccgatatccgttggaaagagcttggtcaacacatatcacaa
attgtgccaatagatgaagatgaagaagtggtaaatgtatacaacgaaaaagattttaaa
aatgaagccttttatattatggctacaaaaaacggcatgattaagaaaagtagtgcttca
caatttaaaactactcggtttaataaaccactcataaatatgaaggttaaagacaaagat
gaacttattaatgtcgttcgattagagtctgatcagttaattactgttctaacccataaa
ggcatgtcattaacttattcaactaatgaattatcggatacaggcttaagagcagctggt
gttaaatcaattaatcttaaagatgaagactatgttgttatgacagaagatgtgaacgac
tcagattccataataatggttacacaacgtggtgctatgaagcgtattgattttaatgtt
cttcaagaagctaaacgcgcacaacgtggaattactttactaaaagaattaaagaaaaaa
ccgcatcgaattgtggcaggtgcagtagttaaagaaaatcacacgaaatatattgtattc
tctcaacatcatgaagaatatggtaatatcgatgatgtacacttatctgaacaatatact
aatggatcatttattattgatactgatgattttggagaagtagaaagtatgattctagag
taa

DBGET integrated database retrieval system