KEGG   Staphylococcus epidermidis RP62A: SERP0938Help
Entry
SERP0938          CDS       T00229                                 

Gene name
trpG
Definition
anthranilate synthase component II (EC:4.1.3.27)
Orthology
K01658  
anthranilate synthase component II [EC:4.1.3.27]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SERP0938 (trpG)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SERP0938 (trpG)
Enzymes [BR:ser01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SERP0938 (trpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
955487..956053
Genome map
AA seq 188 aa AA seqDB search
MILIIDNYDSFTYNLVDIVEKQCETIVKYPDDTDICNLKGITAVIISPGPGHPLDNQLLI
KLIENFENLPILGVCLGAQALTCYYGGDVIQGSCVKHGKVDTLTIVNQSPLYKGIKSSFK
VMRYHSLISDPCSFPESLLITGQTYDSIQSFQHKNRKHYGIQFHPESFATENGKQIIINF
INIATRGS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatattaataatagataactatgattcttttacctacaatcttgtagatattgtagaa
aaacaatgtgaaacgattgttaaatatcccgatgatacagatatatgtaatctgaaaggt
attacagcagttattatttcaccaggacctggacatccattagacaatcaattattaatt
aaattaattgaaaatttcgaaaatttacctattttaggtgtttgcttaggtgcacaagcg
ctcacttgttattacggtggcgatgttatacaaggtagttgtgtcaaacatggaaaagta
gatactttaactattgttaatcagtcaccactatacaaaggaattaagtcaagtttcaaa
gttatgcgttatcattcattaattagtgatccatgctcatttccagaaagtttattaatc
actggccaaacatatgatagtatacaatctttccaacacaaaaacagaaaacattatggc
atacagtttcatccagagtcattcgctacagaaaatgggaaacaaatcattattaatttt
ataaatatagcaacgagaggaagttga

DBGET integrated database retrieval system