KEGG   Staphylococcus epidermidis RP62A: SERP0938Help
Entry
SERP0938          CDS       T00229                                 

Gene name
trpG
Definition
(GenBank) anthranilate synthase component II
  KO
K01658  
anthranilate synthase component II [EC:4.1.3.27]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Quorum sensing
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SERP0938 (trpG)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SERP0938 (trpG)
  Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    SERP0938 (trpG)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SERP0938 (trpG)
Enzymes [BR:ser01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SERP0938 (trpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
955487..956053
Genome map
AA seq 188 aa AA seqDB search
MILIIDNYDSFTYNLVDIVEKQCETIVKYPDDTDICNLKGITAVIISPGPGHPLDNQLLI
KLIENFENLPILGVCLGAQALTCYYGGDVIQGSCVKHGKVDTLTIVNQSPLYKGIKSSFK
VMRYHSLISDPCSFPESLLITGQTYDSIQSFQHKNRKHYGIQFHPESFATENGKQIIINF
INIATRGS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatattaataatagataactatgattcttttacctacaatcttgtagatattgtagaa
aaacaatgtgaaacgattgttaaatatcccgatgatacagatatatgtaatctgaaaggt
attacagcagttattatttcaccaggacctggacatccattagacaatcaattattaatt
aaattaattgaaaatttcgaaaatttacctattttaggtgtttgcttaggtgcacaagcg
ctcacttgttattacggtggcgatgttatacaaggtagttgtgtcaaacatggaaaagta
gatactttaactattgttaatcagtcaccactatacaaaggaattaagtcaagtttcaaa
gttatgcgttatcattcattaattagtgatccatgctcatttccagaaagtttattaatc
actggccaaacatatgatagtatacaatctttccaacacaaaaacagaaaacattatggc
atacagtttcatccagagtcattcgctacagaaaatgggaaacaaatcattattaatttt
ataaatatagcaacgagaggaagttga

DBGET integrated database retrieval system