KEGG   Staphylococcus epidermidis RP62A: SERP0949Help
Entry
SERP0949          CDS       T00229                                 

Definition
transferrin receptor
Orthology
K02016  
iron complex transport system substrate-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
965895..966905
Genome map
AA seq 336 aa AA seqDB search
MKKLLTLISIILYAIVLTACGNDKSGNSYDSKKTVTIKNTYEFKDKNNTHHRGETKTDTV
KVPYNPHRVAVLDYGALDVMKQLGLQNKIVSIAKGQGNAFLPSSLAEFKDDKYSNLGNPG
RPNFDQLAKSKPELILASFRQAHTKTIDEMKKAAPNAKILFVSPDNDHYLSSIKSHTSTI
GKIFNKENEANDLNKKLEQQVTETKKSINHDSVLFLVVDDKGIKAFSSNGRFGGFLNKDL
GIKHVDKNMKDNSAGNNINYEYLNKVNPDKIFVIDRTKNGTDNKEPSILQNKVIENVKAI
KNHQVYQFESNAWYFGEGGNQLTIEQLKRIKDAFQK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattattaacattaatatctattattctttatgcaatagtattaacagcatgc
ggaaatgataaatcaggtaatagttatgattcaaaaaaaacagtgactattaaaaataca
tatgaatttaaggacaagaataatacacatcatcgtggtgaaacgaaaactgacactgtt
aaggtgccttataatccccatcgtgtagcggttcttgattatggtgcactagatgtaatg
aaacaattaggattacaaaataagattgtttcaattgcaaaaggtcaaggaaatgcattc
ttaccttcctctttagctgagtttaaagatgataaatattctaatttaggtaacccaggt
cgaccaaattttgatcaattagctaaatctaaaccagagctcattctagcatcttttaga
caagcccatactaagacaattgacgaaatgaaaaaagcagcacctaatgctaaaattcta
ttcgtaagtccagacaatgatcattatttaagttcaataaaatctcatacatcaacaatt
ggtaaaatattcaataaagagaatgaagccaatgatttaaataaaaaattagaacaacaa
gtaactgaaactaagaaaagtattaatcatgactcagtattattcctagttgttgatgat
aaagggataaaagcatttagttcaaatggtcgctttggaggatttttaaacaaagatttg
ggcattaaacatgttgataaaaacatgaaagataattcagctggaaataatattaattat
gaatatcttaacaaagttaaccctgataaaatatttgtaatagatcgaacgaagaatggc
actgataataaggaaccaagcatcttacaaaataaagttattgaaaatgtaaaagctata
aaaaatcatcaagtttatcaatttgaatccaatgcatggtactttggtgaaggtggcaat
caattaacgattgaacaactcaagagaattaaagatgcattccaaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system