KEGG   Staphylococcus epidermidis RP62A: SERP0950Help
Entry
SERP0950          CDS       T00229                                 

Definition
(GenBank) peptide ABC transporter, ATP-binding protein, putative
  KO
K02032  
peptide/nickel transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Quorum sensing
Module
Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Cellular Processes
  Cellular community
   02024 Quorum sensing
    SERP0950
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    SERP0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(967035..967730)
Genome map
AA seq 231 aa AA seqDB search
MIQFDHVDYSYHRKQPVLKDINISIQRGEKIGILGESGAGKSTIGSLILGQLKPTKGKII
INSSKVLPIFQHATESFDRQFTIEQSLREPLLFYRQLKPQNIKNIILNYLIEFNLSTDLI
TKFPQEVSGGQLQRLNIIRSLLAQPDILVCDEITSNLDVMAEQNVINILLNEKNIENKTL
IVISHDLSVLQRLTNRIIVIKDGQIVDEFKSKDLFNHQRHPYTKLLIQTYE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgattcaatttgatcatgtagattattcatatcatagaaaacagcctgttttaaaagat
attaatataagtattcaacgtggagaaaaaatagggattttaggagaaagcggtgctgga
aaaagtaccattggttctttaatattaggtcaattaaagccaacaaaaggtaaaataatt
atcaattcttctaaggttcttcctatttttcagcatgcgacagaaagttttgatcgtcaa
ttcacgattgaacagtcattgagagagccacttttattttatcgacaattaaaaccacaa
aatatcaaaaatatcattcttaactatttaattgaatttaatttgtctacagatctaata
acaaagtttcctcaagaggtaagtggtgggcaactacaaagattaaatattattcgttct
ctcttagcacaaccagatatattagtttgtgatgaaataacttcgaacttagacgtcatg
gccgaacaaaatgtaatcaatattttacttaatgaaaaaaacattgaaaataaaacatta
attgtcatctcgcatgatttatctgttttacaaaggttaacgaataggataatagttatc
aaagacggtcaaatagtagatgaatttaaaagtaaagatttatttaaccatcaaagacat
ccatatacaaaactattaattcaaacgtatgaataa

DBGET integrated database retrieval system