KEGG   Staphylococcus epidermidis RP62A: SERP0950Help
Entry
SERP0950          CDS       T00229                                 

Definition
peptide ABC transporter ATP-binding protein
Orthology
K02032  
peptide/nickel transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Module
Peptides/nickel transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(967035..967730)
Genome map
AA seq 231 aa AA seqDB search
MIQFDHVDYSYHRKQPVLKDINISIQRGEKIGILGESGAGKSTIGSLILGQLKPTKGKII
INSSKVLPIFQHATESFDRQFTIEQSLREPLLFYRQLKPQNIKNIILNYLIEFNLSTDLI
TKFPQEVSGGQLQRLNIIRSLLAQPDILVCDEITSNLDVMAEQNVINILLNEKNIENKTL
IVISHDLSVLQRLTNRIIVIKDGQIVDEFKSKDLFNHQRHPYTKLLIQTYE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgattcaatttgatcatgtagattattcatatcatagaaaacagcctgttttaaaagat
attaatataagtattcaacgtggagaaaaaatagggattttaggagaaagcggtgctgga
aaaagtaccattggttctttaatattaggtcaattaaagccaacaaaaggtaaaataatt
atcaattcttctaaggttcttcctatttttcagcatgcgacagaaagttttgatcgtcaa
ttcacgattgaacagtcattgagagagccacttttattttatcgacaattaaaaccacaa
aatatcaaaaatatcattcttaactatttaattgaatttaatttgtctacagatctaata
acaaagtttcctcaagaggtaagtggtgggcaactacaaagattaaatattattcgttct
ctcttagcacaaccagatatattagtttgtgatgaaataacttcgaacttagacgtcatg
gccgaacaaaatgtaatcaatattttacttaatgaaaaaaacattgaaaataaaacatta
attgtcatctcgcatgatttatctgttttacaaaggttaacgaataggataatagttatc
aaagacggtcaaatagtagatgaatttaaaagtaaagatttatttaaccatcaaagacat
ccatatacaaaactattaattcaaacgtatgaataa

DBGET integrated database retrieval system