KEGG   Staphylococcus epidermidis RP62A: SERP0951Help
Entry
SERP0951          CDS       T00229                                 

Definition
peptide ABC transporter ATP-binding protein
Orthology
K02031  
peptide/nickel transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Module
Peptides/nickel transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(967733..968509)
Genome map
AA seq 258 aa AA seqDB search
MKLLTIKNLNISDKEEQAIIKNVDLNIYHQSLNVIIGESGAGKSLTVKAILNHLPTQLHM
SFDEFKMQGQNTSGIKQLLGKHIGYISQNYAQSFNEYTRLDKQLIAIYRYHFNVSKDNAL
KKIKKALTWVNLNDESIINKYSFQLSGGQLERVNIASVLMLDPELIIADEPVASLDVVNG
HQIMQLLQHIVKDHHNTVLLITHNMNHVLKYADYFNVMKNGMMIESGEIGKLFNHQHLHR
YTEQLLSYRSKLQKEDNI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacttttaacaataaaaaatctaaacatcagtgataaagaagagcaagcaattatt
aaaaatgtcgacttaaatatatatcatcaatctctaaatgtcattataggtgaaagtggt
gctggaaaaagtttgactgttaaagcaatattaaatcatttacctactcagttacatatg
agtttcgatgaatttaaaatgcaaggtcaaaatacttctggtatcaagcaacttttaggt
aaacatatcggctatatctctcaaaattatgctcaaagttttaatgaatatactcggtta
gataaacaacttatagctatttatcgttatcattttaatgtttccaaggataatgcattg
aaaaagataaaaaaagctttaacttgggttaacttaaatgatgaatcaatcattaataaa
tatagtttccaactttcagggggacaattagagcgagttaatattgctagcgttttaatg
ttagatccagaattaattattgcagatgaacctgttgcatctttagatgtagtgaacggt
catcaaataatgcaactccttcaacatattgtcaaagatcatcataatactgtattactc
atcactcataacatgaatcatgtcctcaaatatgctgattattttaatgtaatgaaaaat
ggcatgatgattgaatctggagaaataggcaaattatttaatcaccaacatcttcatcgg
tatacagaacaattattaagctatagaagcaagctgcaaaaggaggataatatctaa

DBGET integrated database retrieval system