KEGG   Staphylococcus epidermidis RP62A: SERP0953Help
Entry
SERP0953          CDS       T00229                                 

Definition
peptide ABC transporter permease
Orthology
K02033  
peptide/nickel transport system permease protein
Organism
ser  Staphylococcus epidermidis RP62A
Module
Peptides/nickel transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(969316..970317)
Genome map
AA seq 333 aa AA seqDB search
MFKMIIYKLSQMIVVLFILTTITFILMKLSPGNPVDKILHLDISHVSHEQIETTKNKLGL
NDSIFIQWLHWLNQLFHFDLGTSYQTNEPVIREIANYLGPTLIITFGTLIMSLVISIPLG
IIAAIYYHKIWDRIIRVMTSLSVSLPSFFIGLILLYIFSLKLNVLPTSDEGRFASYILPI
ITMSIGMCAYYIRFIRSTLLEQYQTPIVESSRLRGMPERYILFQDILKPTILPIIPLLGL
SIGSLIGGTVVIENLFDIPGLGYFLVDSIKSRDYPVIQGCVLFIGFFVVIINTIADLLSL
LIDPKQRYTITQKETLKFKWLNSHKKEGRNDEV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaatgataatttataaactttcacaaatgattgtcgtactatttatattaact
acaatcacatttatattaatgaaactctctccaggtaatcctgtagacaaaatattacat
cttgatatttcacatgtatctcatgagcaaatagaaacaacaaagaataagcttggctta
aatgattctatttttattcaatggttgcactggttaaatcaattgtttcattttgattta
ggaacaagttatcaaacaaatgagcctgtcatcagagaaatagcaaattaccttggtcct
acacttataattacttttggtacgcttataatgtcgttagttatttctataccattaggg
attatagcagcgatttactatcataaaatttgggataggataatccgtgttatgacatca
ttatccgtaagcctaccatcattttttatcggtcttattttattatatatatttagtttg
aagttgaatgttttaccaacgtcagatgaggggcgtttcgcttcatatattttaccaata
attaccatgagtattggaatgtgtgcttattatattcgatttattcgttctactttatta
gaacaatatcaaacacctatagttgaatcgtctcgtctcagaggtatgcccgaaagatat
atactttttcaagatatccttaaacctacgatactaccaatcatacctctattaggatta
tccattgggagtttgataggtggaacagtagtcattgaaaatttatttgatattcctggg
ttaggctattttttagttgatagtataaagtcgagagattatccagtcattcaaggttgt
gtattatttattggtttctttgttgtgattataaacacaattgcagatttactttcatta
ctcatcgatcctaaacaacgttatactattactcaaaaagaaacattaaagtttaaatgg
ttaaattcacataaaaaagaaggtcgtaacgatgaagtttaa

DBGET integrated database retrieval system