KEGG   Staphylococcus epidermidis RP62A: SERP0957Help
Entry
SERP0957          CDS       T00229                                 

Definition
phosphate transporter ATP-binding protein
Orthology
K02036  
phosphate transport system ATP-binding protein [EC:3.6.3.27]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Phosphate transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ser02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(973640..974515)
Genome map
AA seq 291 aa AA seqDB search
MVNSQVADKEKLDAQTNNQDSVATIVTTENNKKYTIPDSEKKIVYSTQNLDLWYGENHAL
QNINLDILENNVTAIIGPSGCGKSTYIKALNRMVELVPSVKTAGKILYRDQNIFDAKYSK
EKLRTNVGMVFQQPNPFPKSIYDNITYGPKTHGIKNKKILDEIVEKSLRGAAIWDELKDR
LHTNAYGLSGGQQQRVCIARCLAIEPDVILMDEPTSALDPISTLRVEELVQELKENYSII
MVTHNMQQAARVSDKTAFFLNGYVNEYDDTDKIFSNPADKQTEDYISGRFG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggttaattcacaagtagcagacaaagagaaattagacgcacaaacaaataatcaagac
tcagttgccacaatagttactactgaaaacaataagaaatatacaattccagacagtgaa
aagaagattgtttattcaactcaaaatctagatttatggtatggagaaaatcatgcttta
caaaacattaatttagatatattggaaaataatgtgactgcaataatcggaccatctgga
tgtggtaaatctacatacatcaaagctttaaatagaatggtcgaattagttccatctgtg
aaaactgcaggcaaaattttgtatcgtgaccaaaatatatttgatgcaaagtattctaaa
gagaagctacgtactaacgttggaatggtttttcaacaacctaacccattccctaaatca
atttacgataatattacttatggtcctaagactcacggtattaaaaacaaaaaaattcta
gatgaaatcgtagaaaaatcattacgtggcgctgcaatatgggatgaattaaaagataga
ttgcatacaaatgcttatggattatcaggtggacaacaacaacgtgtttgtatagctaga
tgtttagcaattgaaccagatgtcattttaatggatgaacctacgtcagcattagatcct
atttctacattaagagttgaagaacttgtacaagaattaaaagaaaattactcaattatt
atggttacacacaacatgcaacaagctgcgcgtgtttcagataaaactgctttcttctta
aatggatatgtcaatgaatatgatgatactgataaaatcttttcaaatcctgcagacaaa
caaactgaagattatatatctggtcgttttggataa

DBGET integrated database retrieval system