KEGG   Staphylococcus epidermidis RP62A: SERP0958Help
Entry
SERP0958          CDS       T00229                                 

Definition
phosphate ABC transporter permease
Orthology
K02038  
phosphate transport system permease protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Phosphate transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(974603..975508)
Genome map
AA seq 301 aa AA seqDB search
MSTNSNTANKTLIDKDAVEKNISSRDKKNSVNKWLFLLCTLIGLIVLVALLIQTFVKGAG
HLTPEFFTNFSSSTPADAGIKGALVGSIWLILSIIPISIILGIGTAIYLEEYARDNIFTQ
IVKVSISNLAGVPSIVFGLLGYTLFVGAAGLGNSVLAAALTMSLLILPVIIVASQEAIRA
VPSSVREASYGLGANKWQTIRRVVLPAALPGILTGFILSLSRALGETAPLVMIGIPTILL
ATPSGLLDQFSALPTQIYTWAKMPQAEFQNVASAGIIVLLVILLLMNAIAILLRNKFSKK
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaaattcaaatactgctaacaaaacattgattgataaagatgccgtagaaaaa
aatatttcttctcgtgataagaaaaactcggtaaacaaatggttatttttattatgtaca
ttaatagggctcattgttttagtagcactattaattcaaaccttcgttaaaggggcggga
catctaactcccgaatttttcactaatttttcatcttcaacacccgcagatgctggtatt
aaaggggcattagtaggttccatttggttaatcttaagtattattccaattagcatcatt
ttaggaataggtacagccatttatttagaagaatacgcaagagacaatattttcacacaa
atcgtaaaagtgagtatatctaatttagctggtgttccttcaattgtgttcggtttacta
ggttatacattgtttgtgggcgcggcaggtttaggtaatagcgtgttagcagctgctctt
acaatgtcactactaatcttgcctgttattatcgttgctagtcaagaagctatcagagca
gttcctagttcagtcagagaagcatcatatggtcttggtgctaataaatggcaaacaatt
agaagagttgttttaccggcagcattacctggtattttaacaggtttcattttatcttta
tcacgcgcattaggagaaacagcaccacttgtaatgataggtataccaacgatactttta
gcaacaccaagcggattactcgaccaattctctgcgttaccaactcaaatttatacatgg
gcaaaaatgcctcaagcagaattccaaaacgttgcatcagcaggcattatcgttctactc
gttatcttattattgatgaacgctatagcgatacttctacgtaataaatttagtaaaaaa
ttctaa

DBGET integrated database retrieval system