KEGG   Staphylococcus epidermidis RP62A: SERP0959Help
Entry
SERP0959          CDS       T00229                                 

Definition
phosphate ABC transporter permease
Orthology
K02037  
phosphate transport system permease protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Phosphate transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ser02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(975510..976436)
Genome map
AA seq 308 aa AA seqDB search
MASQTKVREMIAKNNAKKGGLSDKIVPIILAIISAISILTTIAILFTLLTETITFFTRVP
LSKFFLSGTWNPTGSSPEFGIWALIIGTLKITVIATIVAVPIGLGAAIYLNEYASDRSRR
IIKPILEILAGIPTIVFGFFALTFVTPILRNLIPNLGEFNSISPGIVVGIMIVPMITSMS
EDAMSSVPDKIREGAFGLGATKFEVATKVVLPAATSGVVASIVLGISRAIGETMIVSLAA
GSSPTSSLSLTSSIQTMTGYIVEIATGDAAFGSDIYYSIYAVGFTLFIFTLIMNLLSQWI
SKRFREEY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcttcacaaacaaaggtgagagaaatgatagctaagaataatgctaaaaagggcgga
ctaagtgataaaattgtcccaattattttagctattatttcagctatatctatattaact
acaattgctattttatttacacttttaactgagacgattacgttcttcacacgagtacca
ttatctaaattctttttatctggtacctggaacccaactggttcatcgccagaatttgga
atttgggcactcatcattggcacattgaaaattactgttattgctacaatcgtggcagtt
ccaattggtttaggtgcagctatttaccttaatgaatatgcatctgatcgttcacgtaga
atcattaaaccaatattagaaattttggctgggattcctacaattgtatttggtttcttt
gctttaacatttgttacacctatattaaggaatctaattcctaacttaggagagtttaat
tcaatcagtcctggtattgttgtgggtataatgatcgtccctatgattacaagtatgagt
gaagatgcgatgtcatctgtacctgataaaattcgtgaaggtgcttttggattaggcgca
actaaatttgaagtcgctacaaaagttgtattaccagctgcgacatcaggcgttgttgct
tcaattgtattaggtatatcaagagcaataggggaaacaatgatcgtttctttagctgct
ggtagttcaccaacatcatctctaagtttaacaagttcaattcaaacgatgacaggatat
attgttgaaattgctacaggtgatgcagcatttggttctgatatttactacagtatttac
gctgtaggatttacacttttcattttcactttaattatgaatttattatcacaatggatc
tctaaacgattcagagaggagtattaa

DBGET integrated database retrieval system