KEGG   Staphylococcus epidermidis RP62A: SERP0962Help
Entry
SERP0962          CDS       T00229                                 

Definition
ABC transporter ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
979345..980952
Genome map
AA seq 535 aa AA seqDB search
MLQVTDVSLRFGDRKLFEDVNIKFTEGNCYGLIGANGAGKSTFLKILSGEIDSQTGHVSL
GKDERLAVLKQDHFAYEDERVLDVVIKGHERLYQVMKEKDEIYMKPDFNDEDGIRAAELE
GEFAEMNGWNAEADAANLLSGLGIEPDLHDKNMSELENNQKVKVLLAQSLFGDPDVLLLD
EPTNGLDIPAISWLEDFLINFENTVIVVSHDRHFLNNVCTHIADLDFGKIKLYVGNYDFW
YQSSQLAQKMAQEQNKKKEEKMKELQDFIARFSANASKSKQATSRKKQLEKIELDDIQPS
SRRYPYVKFTPEREIGNDLLTVENLSKTIDGEKVLDNVSFTMNPNDKAILVGDSEIAKTT
LLKILAGEMEPDEGTFKWGVTTSLSYFPKDNSEFFDDVDMNLVEWLRQYAPEDEQTETFL
RGFLGRMLFSGEEVKKKASVLSGGEKVRCMLSKMMLSSANVLLLDEPTNHLDLESITAVN
DGLKSFKGSIIFTSYDFEFINTIANRVIDLNQAGALSKEVPYEEYLQEIGVLQNN
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgttacaagtaactgatgtaagtttacgttttggtgatcgtaaactatttgaagatgta
aatataaaatttacagagggtaattgttatggattaattggtgcaaatggtgctggaaaa
tctacattcttaaagattttatcaggcgaaattgattcacagactggtcatgtatctcta
ggtaaagatgagcgtttggctgtattaaaacaagatcattttgcttatgaagatgaacgt
gttttagatgttgtgattaaaggacacgaacgtttgtatcaagtgatgaaagagaaagat
gaaatttatatgaaacctgatttcaacgatgaagacggtattcgtgctgcagaacttgaa
ggagaatttgcagaaatgaacggttggaatgctgaagctgatgccgctaatttattatca
ggattaggcatagaacctgacttacatgataaaaatatgtctgaacttgaaaataatcaa
aaagttaaggtattgttagctcaaagtttatttggtgatcctgacgttcttttactagat
gagcctaccaatggtttagatataccagcaataagttggttagaagactttttaattaat
tttgaaaatactgtcattgtcgtttcgcatgaccgtcacttcttaaataatgtttgtact
catatagctgatttagactttggcaaaattaaactttatgttggtaactatgatttctgg
tatcaatcaagtcaattagcacaaaaaatggcacaagaacaaaataagaaaaaagaagaa
aaaatgaaagagttacaagatttcatcgcacgcttctcagcaaatgcttctaaatctaaa
caggcaacaagtcgtaagaaacaattagaaaaaattgaattagacgatatccagccatca
tctcgtagatacccttatgtgaaatttacccctgaacgtgaaattggaaatgatttactt
acagtagaaaatctttctaaaacaattgacggcgaaaaggtactagacaatgtttcattc
actatgaatcctaatgataaagctattttagttggtgatagcgaaattgctaaaacaaca
ttgttaaaaattttagctggagaaatggaaccagatgaaggtacatttaaatggggcgta
acgacatctttaagttacttccctaaagataactctgaattctttgatgatgtcgatatg
aatctagttgaatggttacgtcaatacgccccagaagacgaacaaactgaaacattttta
cgtggtttcttaggacgcatgttatttagtggtgaggaagttaagaaaaaagcaagcgtg
ctttcaggtggagaaaaagtacgttgcatgttaagtaaaatgatgctatcaagtgctaat
gtacttttacttgacgagccaacaaaccatttagatttggaaagtatcactgctgtaaat
gatggattaaaatcatttaaaggttctatcatcttcacttcttatgattttgaatttatt
aatacaatcgcaaatcgagtgattgacttgaatcaagctggtgccctttctaaagaagta
ccttatgaggaatacttacaagaaattggcgtattacaaaataattaa

DBGET integrated database retrieval system