KEGG   Staphylococcus epidermidis RP62A: SERP0972Help
Entry
SERP0972          CDS       T00229                                 

Definition
(GenBank) cold shock protein, CSD family
  KO
K03704  
cold shock protein (beta-ribbon, CspA family)
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Transcription factors [BR:ser03000]
 Prokaryotic Type
  Other transcription factors
   Others
    SERP0972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(990579..990812)
Genome map
AA seq 77 aa AA seqDB search
MKEFSLGGFRVMKQGTVKWFNAEKGFGFIEVEGENDVFVHFSAINQEGYKSLEEGQSVEF
EVVEGDRGPQAANVVKL
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaatttagtcttggaggtttcagagttatgaaacaaggtacagttaaatggttt
aatgccgaaaaaggttttggtttcatcgaagttgaaggagaaaacgacgtattcgtacac
ttctcagcaattaaccaagaaggatacaaatcattagaagaaggtcaatcagttgaattt
gaagtagttgaaggcgatcgcggtcctcaagctgcaaacgttgttaaactataa

DBGET integrated database retrieval system