KEGG   Staphylococcus epidermidis RP62A: SERP0972Help
Entry
SERP0972          CDS       T00229                                 

Definition
CSD family cold shock protein
Orthology
K03704  
cold shock protein (beta-ribbon, CspA family)
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(990579..990812)
Genome map
AA seq 77 aa AA seqDB search
MKEFSLGGFRVMKQGTVKWFNAEKGFGFIEVEGENDVFVHFSAINQEGYKSLEEGQSVEF
EVVEGDRGPQAANVVKL
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaatttagtcttggaggtttcagagttatgaaacaaggtacagttaaatggttt
aatgccgaaaaaggttttggtttcatcgaagttgaaggagaaaacgacgtattcgtacac
ttctcagcaattaaccaagaaggatacaaatcattagaagaaggtcaatcagttgaattt
gaagtagttgaaggcgatcgcggtcctcaagctgcaaacgttgttaaactataa

DBGET integrated database retrieval system