KEGG   Staphylococcus epidermidis RP62A: SERP0988Help
Entry
SERP0988          CDS       T00229                                 

Gene name
arlS
Definition
sensor histidine kinase ArlS
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1005701..1007071)
Genome map
AA seq 456 aa AA seqDB search
MIKRQKLKYKWMLITTLITFTTILLFCLIIIFFLKDTLRSSEIDEAERSSNDIANLFHSK
SLSDISALDLNASLENFQEILIYDDKGRKLIQTSNDNTLAYDNKIDFKHPERIHIHRSHG
INYLVITEPIRSKEFSGYSVLVHSLQNYDNLVKSLYIVALAFGLIATIITAGVSYIFSSQ
ITKPIVTMSNKMNQIRRDGFQNKLELTTNYEETDNLIDTFNEMMYQIEESFNQQRQFVED
ASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEVNRITKLVEELLLLTKDRVN
HNVLECENVDINSEIQSRVKSLQHLHPDYTFETHLATKPIQLKINRHQFEQLLLIFIDNA
MKYDTEHKHIKIVTQLKNKMIMIDITDHGMGIPKADLEFIFDRFYRVDKSRARSQGGNGL
GLSIAEKIVQLNGGMIQVESELQNYTTFKISFPVLN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcgtcaaaaattaaaatataaatggatgcttattacgacgctcattaccttc
acgacaatattacttttctgcttaattattattttctttttaaaagatactttacgaagt
agtgaaattgacgaagctgaaagaagttcaaatgatatcgccaatctgttccattcaaaa
tctttaagtgatatatctgcattggatttaaatgcatccttagaaaattttcaagaaata
ttgatttatgatgataagggtagaaagttaattcaaacatcaaatgataatacacttgct
tatgataacaaaattgatttcaaacatcctgaacgtatacatattcatagaagccacggt
attaattacttagtaataactgaacctatacgttcgaaggaattttctggatacagtgta
ttagtccattctcttcaaaattatgataatctcgttaaatcactttatatcgttgcactt
gcttttggattaattgcaaccattataaccgccggcgtgagttatatcttttcttcgcaa
attactaaaccaatagttacaatgtccaataaaatgaatcaaattagaagagatggtttt
caaaataaacttgaattaactacaaattatgaagaaacagacaatttaattgataccttt
aatgaaatgatgtatcaaatagaagaatcttttaatcagcaacgtcaatttgtcgaggat
gcttcacatgaattaagaacgccactacagattattcaaggtcatctcaatttaattcaa
cgttggggaaaaaaagatccagcagttttggaggaatctttgaatatttcaattgaggaa
gtgaatcgaataacaaaacttgtcgaagaactacttttacttaccaaagatagagtcaat
cataatgttttggaatgtgaaaatgtagacataaatagcgagattcagtcacgtgtgaag
tcactgcaacacctacatccagattatacctttgaaacacatcttgctactaaacctatc
caattaaaaattaaccgtcatcagtttgaacaacttttactcatatttattgataatgca
atgaaatacgatactgaacataagcacattaaaattgttactcaactaaaaaataaaatg
attatgattgatattactgatcatggtatgggtataccaaaagctgacttagaatttatc
tttgatagattttatcgtgtagataaatcacgtgcacgtagtcagggaggcaatggatta
ggactatcaatagctgaaaaaattgtacaacttaacggtggtatgattcaggttgaaagt
gaactacaaaattacacgactttcaaaatcagttttccagtactaaattaa

DBGET integrated database retrieval system