KEGG   Staphylococcus epidermidis RP62A: SERP0989Help
Entry
SERP0989          CDS       T00229                                 

Gene name
arlR
Definition
DNA-binding response regulator ArlR
Orthology
K18941  
two-component system, OmpR family, response regulator ArlR
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Two-component system
Module
ArlS-ArlR (virulence regulation) two-component regulatory system
Multidrug resistance, efflux pump NorA
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SERP0989 (arlR)
Two-component system [BR:ser02022]
 OmpR family
  ArlS-ArlR [MD:M00716]
   SERP0989 (arlR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1007068..1007727)
Genome map
AA seq 219 aa AA seqDB search
MTNILIVEDEQNLARFIELELTHENYTVDIENDGKAGLDKALSKPYDLYILDLMLPNING
LEICRQIRQKTTTPIIIITAKSETYDKVAGLDYGADDYIVKPFDIEELLARIRAVLRRQP
DKDVLDINGIIIDKDAFKVTVNGHQLELTKTEYDLLYVLAENRNHVMQREQILDHVWGYN
SEVETNVVDVYIRYLRNKLKPFNKEKSIETVRGVGYVIR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatattttaatcgtagaagatgagcaaaatcttgctagatttatagagcttgag
ttaactcatgaaaattatactgttgatatagagaatgatggaaaggcaggtttggacaaa
gcattatctaagccctatgatttatatattttagacttaatgcttccaaacataaatggt
ctagaaatttgtagacaaattcgtcaaaaaacaactactccaattatcatcattactgcg
aaaagcgagacatatgataaagtagctgggttggactatggggcagatgactacattgta
aaaccctttgatatagaagaattgctggcaagaataagagcggtattgcgcagacagcca
gataaagatgttttagatatcaatggtattatcattgataaagatgcctttaaagttact
gttaatggccatcaattagaattaactaaaacagaatacgatttactatatgttttagct
gaaaatcgtaaccacgtcatgcaacgtgaacaaattctcgatcacgtatgggggtataat
agtgaagtagaaacgaatgtcgttgatgtttatattcgttatttacgtaataaactcaaa
ccttttaataaagaaaaatccatagaaactgtacgtggcgtagggtatgtgattcgatga

DBGET integrated database retrieval system