KEGG   Staphylococcus epidermidis RP62A: SERP0989Help
Entry
SERP0989          CDS       T00229                                 

Gene name
arlR
Definition
DNA-binding response regulator ArlR
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1007068..1007727)
Genome map
AA seq 219 aa AA seqDB search
MTNILIVEDEQNLARFIELELTHENYTVDIENDGKAGLDKALSKPYDLYILDLMLPNING
LEICRQIRQKTTTPIIIITAKSETYDKVAGLDYGADDYIVKPFDIEELLARIRAVLRRQP
DKDVLDINGIIIDKDAFKVTVNGHQLELTKTEYDLLYVLAENRNHVMQREQILDHVWGYN
SEVETNVVDVYIRYLRNKLKPFNKEKSIETVRGVGYVIR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatattttaatcgtagaagatgagcaaaatcttgctagatttatagagcttgag
ttaactcatgaaaattatactgttgatatagagaatgatggaaaggcaggtttggacaaa
gcattatctaagccctatgatttatatattttagacttaatgcttccaaacataaatggt
ctagaaatttgtagacaaattcgtcaaaaaacaactactccaattatcatcattactgcg
aaaagcgagacatatgataaagtagctgggttggactatggggcagatgactacattgta
aaaccctttgatatagaagaattgctggcaagaataagagcggtattgcgcagacagcca
gataaagatgttttagatatcaatggtattatcattgataaagatgcctttaaagttact
gttaatggccatcaattagaattaactaaaacagaatacgatttactatatgttttagct
gaaaatcgtaaccacgtcatgcaacgtgaacaaattctcgatcacgtatgggggtataat
agtgaagtagaaacgaatgtcgttgatgtttatattcgttatttacgtaataaactcaaa
ccttttaataaagaaaaatccatagaaactgtacgtggcgtagggtatgtgattcgatga

DBGET integrated database retrieval system