KEGG   Staphylococcus epidermidis RP62A: SERP0997Help
Entry
SERP0997          CDS       T00229                                 

Definition
hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1014346..1014570)
Genome map
AA seq 74 aa AA seqDB search
MVKNYSFYQFIMTVRGRKDDKGVFAEQIFEDLAFPKHEDDFNTLSEYIETHSEFTLPMSV
FDDLYDDYTEWLKF
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaattattcattttatcaatttattatgaccgtgcgcggaagaaaagacgat
aaaggtgtttttgctgagcaaatttttgaagaccttgcctttccaaaacacgaagatgat
tttaatacattatctgaatatattgagacacatagcgaattcaccctaccaatgtctgta
tttgatgacttatatgatgactatacagaatggttgaagttttaa

DBGET integrated database retrieval system