KEGG   Staphylococcus epidermidis RP62A: SERP1004Help
Entry
SERP1004          CDS       T00229                                 

Definition
ABC transporter ATP-binding protein
Orthology
K02003  
putative ABC transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Module
Putative ABC transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1018790..1019452)
Genome map
AA seq 220 aa AA seqDB search
MLEFKQVSKSFRDGNQMIQAVKPTDLKIIQGELIAIVGPSGSGKSTFLTMAGALQRPTSG
NIYINNKNISILSEKQLSQIRINEIGFILQSTNLVPFLTIEQQFKLLGKYKKDTLSEDEY
QKLVKQLNLSDITNQLPNQISGGQKQRVAIAKAIYTNPSIILADEPTASLDTNNAMAVMK
ILQKQTKERNKTCVIVTHDERLTHFCDKTYFMEDGVLSLQ
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgttagagttcaaacaagtgagcaaatctttcagagatggcaatcaaatgattcaggca
gtaaaacctaccgatttaaaaataattcagggggaactgattgctatcgtgggaccctca
ggttcagggaaaagtacatttttaactatggctggcgccttacaaagacctacgtcagga
aatatttacatcaataacaaaaatatatcaatattatctgaaaaacagttatctcaaata
agaattaacgaaataggttttatattacaatcgacgaatctcgtgccttttttaacaatc
gaacaacaattcaaacttcttggtaaatataaaaaagatacattaagtgaagatgaatac
caaaagttggttaaacagctaaatttatcggatattaccaatcaattaccaaatcaaata
tctggcggtcaaaaacagcgcgtggcaatagctaaagctatttacacaaatccatcaatc
atactagcagatgaacctaccgcttcactagatacgaataatgcaatggctgtaatgaaa
atacttcaaaaacaaacgaaagaaagaaataaaacatgtgtgattgttactcatgatgaa
cgtttaactcatttttgtgataaaacatatttcatggaggatggagttctttcactccaa
tag

DBGET integrated database retrieval system