KEGG   Staphylococcus epidermidis RP62A: SERP1028Help
Entry
SERP1028          CDS       T00229                                 

Definition
(GenBank) glycosyl transferase, group 1 family protein
  KO
K00754  
L-malate glycosyltransferase [EC:2.4.1.-]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     SERP1028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1074331..1075473)
Genome map
AA seq 380 aa AA seqDB search
MKIGITCYPSMGGSGIIATELGIKMAERGHEVHFITSNIPFRIRKPLPNMTFHQVEVNQY
AVFQYPPYDITLSTKISDVIQEYDLDILHMHYAVPHAVCGILAKQMSGKNVKIMTTLHGT
DITVLGYDHTLQNAIKFGIEQSDIVTSVSHSLAQQTYEIINTKKEIIPIYNFVRENEFPT
RHNEELKDCYGISPEEKVLIHVSNFRKVKRIDTVIETFAKVHESIPSKLILLGDGPELID
MRHKARELDVETHVLFLGKQNDVSAFYQLSDLVLLLSEKESFGLTLLEAMKTGVLPIGSH
AGGIKEVIRHEETGFIVDIGDSTQAAKYAIKLLSNPELYQKMQSQMLKDIEARFSSDLIT
DQYENYYRKMLEQGENNNES
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggtataacgtgttacccgtccatgggtggttctggcattattgctacagaa
ctcggtattaaaatggcagaacgtggccatgaagttcactttattacctcaaacataccc
tttagaatacgcaaacctttacctaacatgacgttccaccaagttgaagtcaatcaatat
gccgtattccaatatccaccatacgatattacattaagtacaaaaatttctgacgttata
caagaatatgatttagacatattgcatatgcattatgctgtacctcacgctgtatgtggt
atattagcgaaacaaatgtcaggtaaaaacgtcaaaattatgacaacactacatggcact
gatataactgtgttaggttatgaccatactttacaaaacgcgataaaatttggcatagaa
caaagtgatattgtaacaagtgttagccattctctagcacagcaaacttatgaaattatc
aatactaaaaaggaaatcatccctatatataattttgtaagggaaaatgaattcccaact
cggcataatgaagaattaaaagattgttatggtatttcacctgaagaaaaggtattgata
catgtttctaatttcagaaaagtaaaacgtattgatacagtgattgagacatttgcaaaa
gttcatgagagtataccatccaagttgatacttttaggagatggtccagaattaatcgat
atgcgacataaagcacgagaacttgatgttgaaacacacgtactctttttaggcaaacaa
aatgacgtaagcgcattctaccaactatctgatttagtactactcttaagtgagaaagaa
agttttggattaactctcttagaagcaatgaaaacaggcgtcttacctatagggagtcat
gcaggtggtattaaagaggtcatcagacatgaagaaactggatttatagtagatataggg
gatagtacacaagctgcaaaatatgctattaaacttttatcaaatccagagttatatcaa
aaaatgcaatcacaaatgctgaaagatattgaagcaagatttagttcagatttaattact
gaccaatatgaaaactattatcgaaagatgctagaacaaggtgagaacaacaatgagtca
tga

DBGET integrated database retrieval system