KEGG   Staphylococcus epidermidis RP62A: SERP1028Help
Entry
SERP1028          CDS       T00229                                 

Definition
glycosyl transferase, group 1 family protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1074331..1075473)
Genome map
AA seq 380 aa AA seqDB search
MKIGITCYPSMGGSGIIATELGIKMAERGHEVHFITSNIPFRIRKPLPNMTFHQVEVNQY
AVFQYPPYDITLSTKISDVIQEYDLDILHMHYAVPHAVCGILAKQMSGKNVKIMTTLHGT
DITVLGYDHTLQNAIKFGIEQSDIVTSVSHSLAQQTYEIINTKKEIIPIYNFVRENEFPT
RHNEELKDCYGISPEEKVLIHVSNFRKVKRIDTVIETFAKVHESIPSKLILLGDGPELID
MRHKARELDVETHVLFLGKQNDVSAFYQLSDLVLLLSEKESFGLTLLEAMKTGVLPIGSH
AGGIKEVIRHEETGFIVDIGDSTQAAKYAIKLLSNPELYQKMQSQMLKDIEARFSSDLIT
DQYENYYRKMLEQGENNNES
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggtataacgtgttacccgtccatgggtggttctggcattattgctacagaa
ctcggtattaaaatggcagaacgtggccatgaagttcactttattacctcaaacataccc
tttagaatacgcaaacctttacctaacatgacgttccaccaagttgaagtcaatcaatat
gccgtattccaatatccaccatacgatattacattaagtacaaaaatttctgacgttata
caagaatatgatttagacatattgcatatgcattatgctgtacctcacgctgtatgtggt
atattagcgaaacaaatgtcaggtaaaaacgtcaaaattatgacaacactacatggcact
gatataactgtgttaggttatgaccatactttacaaaacgcgataaaatttggcatagaa
caaagtgatattgtaacaagtgttagccattctctagcacagcaaacttatgaaattatc
aatactaaaaaggaaatcatccctatatataattttgtaagggaaaatgaattcccaact
cggcataatgaagaattaaaagattgttatggtatttcacctgaagaaaaggtattgata
catgtttctaatttcagaaaagtaaaacgtattgatacagtgattgagacatttgcaaaa
gttcatgagagtataccatccaagttgatacttttaggagatggtccagaattaatcgat
atgcgacataaagcacgagaacttgatgttgaaacacacgtactctttttaggcaaacaa
aatgacgtaagcgcattctaccaactatctgatttagtactactcttaagtgagaaagaa
agttttggattaactctcttagaagcaatgaaaacaggcgtcttacctatagggagtcat
gcaggtggtattaaagaggtcatcagacatgaagaaactggatttatagtagatataggg
gatagtacacaagctgcaaaatatgctattaaacttttatcaaatccagagttatatcaa
aaaatgcaatcacaaatgctgaaagatattgaagcaagatttagttcagatttaattact
gaccaatatgaaaactattatcgaaagatgctagaacaaggtgagaacaacaatgagtca
tga

DBGET integrated database retrieval system