KEGG   Staphylococcus epidermidis RP62A: SERP1043Help
Entry
SERP1043          CDS       T00229                                 

Definition
(GenBank) GTP-binding protein, Era/TrmE family
  KO
K03977  
GTPase
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Ribosome biogenesis [BR:ser03009]
 Prokaryotic Type
  GTPases
   SERP1043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1087991..1089301)
Genome map
AA seq 436 aa AA seqDB search
MTKPIVAIVGKPNVGKSTIFNRVVGERISIVEDTPGVTRDRIYSSGEWLTHEFNIIDTGG
IEIGDAPFQTQIRAQAEIAIEEADVIIFMVNVREGLTQSDEMVAQMLYKSKKPVVLAVNK
VDNLEMRNDIYDFYSLGFGDPYPISGSHGLGLGDLLDAVVENFNKESEDPYDEDTIRLSI
IGRPNVGKSSLVNAILGEERVIVSNVAGTTRDAIDTEYSYDGQDYVLIDTAGMRKKGKVY
ESTEKYSVLRALKAIERSEVVLVVIDAEQGIIEQDKRVAGYAHEEGKAIVIVVNKWDTVE
KDSKTMKKFTDDVRNEFQFLDYAQIAFVSAKEGLRLKTLFPYINQASENHKKRVQSSTLN
EVVTDAISMNPTPTDKGRRLNVFYTTQVAIEPPTFVVFVNDVELMHFSYRRYLENQIRNA
FGFEGTPIHIIPRKRN
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaccgatagtagcaattgtaggaaaaccaaatgtaggaaaatctacaattttt
aatagagttgtcggcgaacgtatatctatcgtagaagatacgccaggcgttactcgtgat
cgtatttattcatctggcgagtggttaactcatgaatttaacatcattgatacaggtggt
attgaaattggagatgctccttttcaaactcaaatccgtgcacaggcagaaatagcaatt
gaagaagcagatgtcatcatttttatggtcaatgttagagaaggacttacacaaagtgac
gaaatggtcgcacaaatgctttataaatctaagaaacctgttgtattagctgtgaataaa
gttgataatcttgaaatgcgtaatgatatctatgatttctattctttaggctttggagat
ccatatcctatttctggttcacatggattaggacttggagatttgctagatgcagttgtt
gaaaactttaataaagaatcagaagatccttatgacgaagatacgatacgtctttctatc
atcggtagacctaatgttggtaaatctagcttggtcaatgctattttaggcgaagaacgt
gttattgtgtctaatgttgctggtacaactcgagatgccattgataccgagtactcttat
gatggacaagattatgtattgattgatactgctggaatgagaaaaaaaggtaaggtgtat
gaatcgactgaaaaatattctgtattacgtgcattaaaagcgattgagcgttcagaagta
gtattagtagttatcgatgctgaacaaggtataattgaacaagataaacgtgtagctggc
tatgcacatgaggaaggtaaagctattgtcattgtagtaaataaatgggatacagttgaa
aaagatagtaagacaatgaaaaaattcactgatgatgttagaaatgaatttcaattttta
gattatgctcaaatcgcgttcgtatcagcaaaagaagggctaagattaaaaacattattc
ccttatatcaatcaagccagtgaaaatcataaaaagcgtgtccaaagttctacactaaat
gaagttgttactgatgccatctctatgaatccaacacctactgacaaaggtagaagactt
aatgtattctatacaactcaggttgcaattgaaccaccgacatttgtagtatttgtcaat
gatgttgaattaatgcatttttcttataggagatatttagaaaatcaaatacgtaatgct
tttggttttgaaggaacacctattcatattattccaagaaaaagaaattaa

DBGET integrated database retrieval system