KEGG   Staphylococcus epidermidis RP62A: SERP1043Help
Entry
SERP1043          CDS       T00229                                 

Gene name
engA
Definition
GTP-binding protein EngA
Orthology
K03977  
GTP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1087991..1089301)
Genome map
AA seq 436 aa AA seqDB search
MTKPIVAIVGKPNVGKSTIFNRVVGERISIVEDTPGVTRDRIYSSGEWLTHEFNIIDTGG
IEIGDAPFQTQIRAQAEIAIEEADVIIFMVNVREGLTQSDEMVAQMLYKSKKPVVLAVNK
VDNLEMRNDIYDFYSLGFGDPYPISGSHGLGLGDLLDAVVENFNKESEDPYDEDTIRLSI
IGRPNVGKSSLVNAILGEERVIVSNVAGTTRDAIDTEYSYDGQDYVLIDTAGMRKKGKVY
ESTEKYSVLRALKAIERSEVVLVVIDAEQGIIEQDKRVAGYAHEEGKAIVIVVNKWDTVE
KDSKTMKKFTDDVRNEFQFLDYAQIAFVSAKEGLRLKTLFPYINQASENHKKRVQSSTLN
EVVTDAISMNPTPTDKGRRLNVFYTTQVAIEPPTFVVFVNDVELMHFSYRRYLENQIRNA
FGFEGTPIHIIPRKRN
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaccgatagtagcaattgtaggaaaaccaaatgtaggaaaatctacaattttt
aatagagttgtcggcgaacgtatatctatcgtagaagatacgccaggcgttactcgtgat
cgtatttattcatctggcgagtggttaactcatgaatttaacatcattgatacaggtggt
attgaaattggagatgctccttttcaaactcaaatccgtgcacaggcagaaatagcaatt
gaagaagcagatgtcatcatttttatggtcaatgttagagaaggacttacacaaagtgac
gaaatggtcgcacaaatgctttataaatctaagaaacctgttgtattagctgtgaataaa
gttgataatcttgaaatgcgtaatgatatctatgatttctattctttaggctttggagat
ccatatcctatttctggttcacatggattaggacttggagatttgctagatgcagttgtt
gaaaactttaataaagaatcagaagatccttatgacgaagatacgatacgtctttctatc
atcggtagacctaatgttggtaaatctagcttggtcaatgctattttaggcgaagaacgt
gttattgtgtctaatgttgctggtacaactcgagatgccattgataccgagtactcttat
gatggacaagattatgtattgattgatactgctggaatgagaaaaaaaggtaaggtgtat
gaatcgactgaaaaatattctgtattacgtgcattaaaagcgattgagcgttcagaagta
gtattagtagttatcgatgctgaacaaggtataattgaacaagataaacgtgtagctggc
tatgcacatgaggaaggtaaagctattgtcattgtagtaaataaatgggatacagttgaa
aaagatagtaagacaatgaaaaaattcactgatgatgttagaaatgaatttcaattttta
gattatgctcaaatcgcgttcgtatcagcaaaagaagggctaagattaaaaacattattc
ccttatatcaatcaagccagtgaaaatcataaaaagcgtgtccaaagttctacactaaat
gaagttgttactgatgccatctctatgaatccaacacctactgacaaaggtagaagactt
aatgtattctatacaactcaggttgcaattgaaccaccgacatttgtagtatttgtcaat
gatgttgaattaatgcatttttcttataggagatatttagaaaatcaaatacgtaatgct
tttggttttgaaggaacacctattcatattattccaagaaaaagaaattaa

DBGET integrated database retrieval system