KEGG   Staphylococcus epidermidis RP62A: SERP1054Help
Entry
SERP1054          CDS       T00229                                 

Gene name
srrB
Definition
sensor histidine kinase SrrB
Orthology
K07651  
two-component system, OmpR family, sensor histidine kinase ResE [EC:2.7.13.3]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Two-component system
Module
ResE-ResD (aerobic and anaerobic respiration) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SERP1054 (srrB)
Enzymes [BR:ser01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SERP1054 (srrB)
Protein kinases [BR:ser01001]
 Histidine protein kinases
  OmpR family
   SERP1054 (srrB)
Two-component system [BR:ser02022]
 OmpR family
  ResE-ResD [MD:M00458]
   SERP1054 (srrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1099964..1101733)
Genome map
AA seq 589 aa AA seqDB search
MMNRLNSVVIKLWLTIILIVATVLILLSVSLITFIQYYFTQETENAIKEDAKRISSLVEK
SHNKTLAIQNSQTLIDGDGPGGLIIMKDMSEKPDSSYKDTKKQMFNEIKKSTKFKKVFKE
GEYETQNITIKNKGNSQSYLLLGYPMKAQKGAQSHYSGVFIYKDLKSIEDTNNAITIIIL
ITAIIFTIASTIFAFFLSNRITKPLRQLKTQAQKVSEGDYSQISTVATKDEIGDLSRAFN
NMNVEIQEHIKAISSSKNIRDTLLNSMVEGVLGINNQREIILSNKMADDIMRHIDDFSKE
SIEQQIEATFESQQNEYLELEINTRYYVFISSYIDRIQTNGRSGIVMVIRDMTNEHNLDQ
MKKDFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIRDSLAIVLDESKRLNRLVNELL
NVARMDAEGLSVEKELQPIQHLLDKMESKYRMQSEELGLTMTFDSNNDEQLWNYDMDRMD
QVLTNLIDNATRYTQAGDSIKISIDEDSDFNILTITDTGTGIAPEHLKQVFDRFYKVDAA
RKRGKQGTGLGLFICKMIIEEHGGRIDVESELGKGTSFIIRLPKSKQIS
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaccgactaaatagtgttgttataaaactgtggttaactattattttaatagta
gcgacagttttaattttattaagtgtttcattaatcacttttatacaatattactttacg
caagaaacagaaaatgcaattaaagaagatgccaaaagaattagttcacttgttgagaag
tctcataacaaaacattagctatccaaaatagccaaacactcattgatggtgatggaccg
ggtggcctcattattatgaaagacatgagcgagaaaccagactcatcgtataaagacact
aaaaaacaaatgtttaatgaaataaaaaagagtactaaatttaaaaaagtgtttaaagaa
ggtgagtatgaaactcaaaatattacaataaaaaataaaggtaattctcaatcttatctt
ttgctaggatacccaatgaaagctcaaaaaggtgctcaaagtcattatagtggtgttttt
atatataaagatttgaaatctatcgaagatacaaataatgctattacaattattatatta
ataactgctattatatttactatagcaagcacaatatttgcattctttttatctaataga
ataacgaaacccttacgtcaattaaaaacacaagcacaaaaagtttctgaaggggattat
agtcaaatttcaactgtcgctactaaagatgaaataggtgatttatcacgtgcatttaac
aacatgaacgtagaaattcaagaacatatcaaagcaatttcttcatctaagaatataaga
gatacattattaaactctatggtagaaggcgttctaggcattaataatcaacgtgaaatc
atattgtcgaacaagatggctgatgatattatgcgtcacattgatgatttttcaaaagaa
tctattgaacagcaaattgaagcaacatttgaatcacaacagaatgagtatttagaatta
gaaattaatacaaggtactatgtatttatctccagttatatagatagaattcaaacaaat
ggtagaagtggtattgtcatggtcatccgtgatatgacaaatgaacataatcttgatcaa
atgaaaaaagattttatagcaaatgtatcacatgaattacgtacgccaatctctttatta
cagggttacactgagtccatagtagacggtatagttaccgaaccagatgaaatacgtgac
tcattagcaatcgttttagatgaatctaagcgacttaatcgtttagtcaatgaattacta
aatgtagctcgtatggatgctgaaggattatcagttgagaaggaattacaacctattcaa
caccttcttgataaaatggagtctaaatatcgcatgcaaagtgaagaattaggtttaaca
atgacgtttgattctaataatgacgaacaattatggaactatgatatggatagaatggac
caagtgttaactaatttaattgataacgcaacaagatatacacaagctggtgattctata
aagatttctattgatgaagattcagatttcaatattttaacaataactgatacaggcact
ggtatagcaccggaacatctgaaacaagtatttgaccgtttttataaagtggacgctgct
cgaaaaagaggtaagcaaggcaccggattaggacttttcatttgtaaaatgattattgaa
gaacacgggggacgtattgatgttgagagcgaattaggcaaaggtacttcatttattatt
agactacctaaatcaaaacaaattagttag

DBGET integrated database retrieval system