KEGG   Staphylococcus epidermidis RP62A: SERP1055Help
Entry
SERP1055          CDS       T00229                                 

Gene name
srrA
Definition
DNA-binding response regulator SrrA
Orthology
K07775  
two-component system, OmpR family, response regulator ResD
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Two-component system
Module
ResE-ResD (aerobic and anaerobic respiration) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SERP1055 (srrA)
Two-component system [BR:ser02022]
 OmpR family
  ResE-ResD [MD:M00458]
   SERP1055 (srrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1101714..1102439)
Genome map
AA seq 241 aa AA seqDB search
MTNEILIVDDEDRIRRLLKLYLERESFEIHEARDGKEAYELALENNYACILLDLMLPEMD
GIEVASKLREHKDTPIIMLTAKGEETNRVEGFESGADDYIVKPFSPREVVLRVKALLRRT
QTANTEQSEPHARDIIEFSHLVIDNDAHRVLADDQQVNLTPKEYELLIYLAKTPNKVFDR
EQLLKEVWHYEFYGDLRTVDTHVKRLREKLNRVSSDAAQMIQTVWGVGYKFEVKPSDEPT
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgactaacgaaattttaatcgttgatgatgaagatagaattagaagattacttaaatta
tatttagaaagagaatcttttgaaattcatgaagcaagagatggtaaagaagcctacgag
cttgctcttgaaaacaactatgcgtgcatcctcttagatttaatgcttcctgaaatggat
ggaattgaagttgcctctaaacttagagaacataaagatacacctatcatcatgcttact
gcaaaaggtgaagaaacaaatcgtgttgaaggatttgaatcgggagcagatgattatatt
gttaagcctttctcacctagagaagtagtattgagagtaaaggcgttattaagacgtaca
caaactgcaaacactgagcaaagcgaaccgcatgcacgcgatattattgaatttagtcat
ctagtgattgataatgacgctcatcgagtccttgcggatgatcaacaagtgaatctaaca
cctaaagagtatgaattactcatctatttagctaaaactccaaataaagtatttgatcga
gaacagttacttaaagaggtttggcattacgaattttatggggacttgcgtacagtagac
actcacgtcaaaagacttagagaaaagttaaatcgagtatcaagtgatgctgcacaaatg
atacaaactgtgtggggtgtcggttataaatttgaggtaaaacctagtgatgaaccgact
aaatag

DBGET integrated database retrieval system