KEGG   Staphylococcus epidermidis RP62A: SERP1060Help
Entry
SERP1060          CDS       T00229                                 

Gene name
xerD
Definition
tyrosine recombinase XerD
Orthology
K04763  
integrase/recombinase XerD
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1105244..1106131)
Genome map
AA seq 295 aa AA seqDB search
MNTIIEEYLNFIQIEKGLSNNTIGAYRRDLKKYKDYLEDNKISHIDFIDRQIIQECLGHL
IDMGQSSKSLARFISTIRSFHQFALREKYAAKDPTVLIETPKYEKKLPDVLEIDEVIALL
ETPDLTKNNGYRDRTMLELLYATGMRVTEIIQLDVEDVNLMMGFVRVFGKGNKERIVPLG
DTVIEYLTTYIETVRPQLLKQTTTQALFLNMHGKSLSRQGIWKIIKQYGLKANINKTLTP
HTLRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYTQFHPRA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaatactatcattgaagaatatttaaatttcattcaaattgaaaaaggattaagtaac
aatactataggagcgtatcgaagagatttaaaaaaatataaagattatcttgaagataac
aagatttcacatatcgattttattgatagacaaattatccaagagtgtcttggacacctt
atagatatggggcaatcttcaaaatctctcgcaaggtttatttctacaataagaagcttt
catcagtttgcattacgcgaaaaatatgctgctaaagacccaactgttttaattgaaaca
cccaaatatgaaaagaaattaccagatgtgcttgaaatagacgaagtaatagcattactg
gaaacgcctgatttaactaagaataatggatatcgtgatcgtacgatgttggagctttta
tacgccacaggtatgcgtgtaactgaaattattcaattagatgttgaagacgtaaactta
atgatgggatttgtaagagttttcgggaaagggaataaggaaagaatcgttcccttagga
gataccgtcatcgaatatttaactacatatattgaaaccgtaagacctcaattactcaaa
caaaccacaactcaagcgctatttcttaacatgcatggaaagtctttatcaagacaaggc
atttggaaaatcattaaacaatatggtttgaaagctaatatcaataaaacgcttacacca
catacattacggcattcatttgcaacacatctcttagaaaatggtgctgatttaagagcc
gtacaagaaatgttaggtcactctgatatttctacaactcaactttatacacatgtatct
aaatcacaaattagaaaaatgtatacgcagtttcatccaagagcttag

DBGET integrated database retrieval system