KEGG   Staphylococcus epidermidis RP62A: SERP1069Help
Entry
SERP1069          CDS       T00229                                 

Definition
AraC family transcriptional regulator
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1113297..1114178
Genome map
AA seq 293 aa AA seqDB search
MDVIKQIQQAIVYIEDRLLEPFNLQELSDYVGLSPYHLDQSFKMIVGQSPEEYARARKMT
IAANDVVNGASRLMDVAKKYRYANSNDFANDFSDFHGISPIQATTKKDELKIQQRLYIKL
STTENAPYTYRLQETDDISLVGYSRFIPTEQLSNPFNIPDFLEDLLVDGYIKELKRYNDT
SPYELFVVSCPLEQGLEIFVGVPSERYPSHLESRFLPGRHYALFNLQGEIDYATNEAWYY
IESSLQLTLPYERNSLYVEIYPLDISFNDPFTKIQLWLPIKQEIYDLDEGYQN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttggacgttatcaagcaaatacaacaggcaattgtatatattgaggatcgtttgttagag
ccttttaatttgcaagaattaagtgattacgttggtctttctccgtatcatttggatcaa
tcttttaagatgatagttggtcagtccccagaggaatatgcgcgtgcacgtaaaatgaca
atagcagcaaacgatgtagttaatggagctagtcgattaatggatgttgctaagaaatat
cgttatgcgaattctaatgatttcgcaaatgattttagcgattttcatggtatctcacct
attcaagctacaacaaaaaaagatgaactaaaaatacagcaacgactgtatataaaatta
tcaacgactgaaaatgcaccctatacatacagacttcaagagactgatgatatttcttta
gttggctattcaagatttattcctactgagcaattatcaaatccatttaatattccagac
tttttagaggatctattagtagatggttatattaaagaacttaaacgttataatgatacg
agcccgtatgaattatttgtagtcagctgtcctctggaacaaggtttagaaatatttgtt
ggtgttccgagtgaacgttacccttcacatcttgaaagcagatttttacctggtcgccat
tatgcattgtttaatttacaaggtgaaattgattatgctacaaacgaggcttggtattat
attgagtctagcttgcaacttactttaccttatgagcgaaatagtttatatgttgagatt
tatccacttgatatttcatttaatgacccattcactaagattcaattatggttgcctatt
aaacaagaaatctatgatttagatgaaggttatcaaaattaa

DBGET integrated database retrieval system