KEGG   Staphylococcus epidermidis RP62A: SERP1072Help
Entry
SERP1072          CDS       T00229                                 

Definition
(GenBank) peptidase T-like protein
  KO
K01258  
tripeptide aminopeptidase [EC:3.4.11.4]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.4  tripeptide aminopeptidase
     SERP1072
Peptidases [BR:ser01002]
 Metallo Peptidases
  Family M20
   SERP1072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1117752..1118876)
Genome map
AA seq 374 aa AA seqDB search
MINQKRLLDCFLELVQIDSETGHEETIQPYLKDTFEKMGLHVIEDEASKNNRLGANNLIC
TLKSNISHQNVPKIYFTSHMDTVVPGKNIQPVVKEDGYVYSDGTTILGADDKAGLAAIIE
AIKQIKESNLPHGQIQIIITVGEESGLVGAKAIDTRLLDADFGYAVDASKDVGTTVIGAP
TQVKIYTTIKGKTAHASTPKKGISAINIASKAISRMKLGQVDALTTANIGKFHGGCATNI
IADEVTLEAEARSHDDQSINKQVKHMKETFETTANELGGQAEVLVEKSYPGFEVSEADKV
TQYAISSALALGLKGDTCIAGGGSDGNIMNQYGIPSVILGVGYENIHTTSERIAIKDMYM
LTRQIIKIIELVAE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgattaatcaaaaacgtttattagattgttttctagaattagtgcaaattgattcggaa
acagggcacgaagaaacaattcaaccttatcttaaagatacgtttgaaaaaatggggctc
catgttattgaagatgaagcttcaaaaaataatagattaggtgctaacaatcttatttgt
acgttaaaaagtaatataagtcatcagaatgtgccgaaaatttattttacaagccacatg
gatactgtcgttccaggaaaaaacatccaacctgtagtaaaagaagatggatacgtttat
agcgatggaactacgatactcggggcggacgataaagccggtcttgcggcaataattgaa
gcgattaaacaaattaaggaatcaaatttgccacacggacagattcaaataattattacc
gtgggagaggaatctggattagtaggtgctaaagcaatagatactcgccttcttgatgca
gatttcggctatgctgtagatgcaagtaaagatgttggaactactgttatcggtgctcca
actcaagtaaagatttatacaactataaaagggaaaaccgcccatgcaagcacacctaaa
aaaggtattagcgcaataaatattgcatcaaaagcaatcagtcgaatgaaattgggacaa
gtcgatgcattaacaacagccaatataggtaaatttcacggaggttgtgccactaatatt
atagctgatgaagtcactttagaggcagaagcacggtcacatgatgatcaaagcattaat
aaacaagtgaaacatatgaaagagactttcgaaacgacagcaaatgaattaggcggtcaa
gctgaagtgttagttgaaaaaagttatccgggatttgaagttagtgaagctgacaaagta
acacaatatgctatatctagtgcattagccctcggtctaaaaggtgatacttgtattgct
ggtggtggttcagacggcaacatcatgaatcaatatggcattccttctgtgattttagga
gtaggatatgaaaacatacatactacttcggaaagaatagcaataaaggatatgtatatg
ctcacaagacaaataataaaaattattgagctagtagctgaataa

DBGET integrated database retrieval system