KEGG   Staphylococcus epidermidis RP62A: SERP1076Help
Entry
SERP1076          CDS       T00229                                 

Definition
2-oxoisovalerate dehydrogenase E2
Orthology
K09699  
2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [EC:2.3.1.168]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SERP1076
Enzymes [BR:ser01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.168  dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
     SERP1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1120886..1122205)
Genome map
AA seq 439 aa AA seqDB search
MDIKMPKLGESVHEGTIEQWLVSVGDHVDEYEPLCEVITDKVTAEVPSTISGTITELVVE
EGQTVNINTVICKIDSENGQNQTESANEFKEEQNQHSQSNINVSQFENNPKTHESEVHTA
SSRANNNGRFSPVVFKLASEHDIDLTQVKGTGFEGRVTKKDIQNIINNPNDQEKEKEFKQ
TDKKDHSTNHCDFLHQSSTKNEHSPLSNERVVPVKGIRKAIAQNMVTSVSEIPHGWMMVE
ADATNLVQTRNYHKAQFKQNEGYNLTFFAFFVKAVAEALKVNPLLNSTWQGDEIVIHKDI
NISIAVADDDKLYVPVIKNADEKSIKGIAREINDLATKARLGKLAQSDMQNGTFTVNNTG
SFGSVSSMGIINHPQAAILQVESVVKKPVVIDDMIAIRNMVNLCISIDHRILDGVQTGKF
MNLVKKKIEQYSIENTSIY
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
ttggatataaaaatgcctaagcttggtgaaagtgtgcatgaaggtacgattgaacaatgg
ttagtatcagtaggagatcatgtagatgagtatgaaccattatgtgaagttattacagat
aaagtaacagctgaagtgccttcaacaatttctggaacaataacagaattagtggttgaa
gaaggacaaactgtcaatattaacacggtgatttgtaaaatcgattcggaaaatggtcaa
aatcaaacagaatcggcaaatgagtttaaggaagaacaaaatcagcattctcaatcaaat
ataaacgtgtcacaattcgaaaataatcctaaaactcatgaaagtgaggtgcatacagcc
tctagtcgcgcaaataacaatggacgattttcaccagttgtctttaaattagcttctgaa
catgatattgatttaacacaagtcaaaggaactggttttgaaggtcgtgttactaagaaa
gatattcaaaatattattaacaatccaaacgatcaagaaaaagagaaagaatttaaacaa
acagataaaaaagatcattcaacgaaccattgtgactttttacatcaatcctcaactaaa
aacgaacactcaccattatcaaatgaacgtgtcgtaccagttaaaggtattagaaaagct
atcgcacaaaatatggttactagtgtcagcgaaataccacacggttggatgatggttgaa
gctgatgcaacgaatttggttcagactagaaactatcataaagctcaatttaaacagaat
gagggttacaatttaactttctttgcgttttttgtaaaagctgttgcagaggctttaaaa
gtaaatccattactcaatagtacatggcaaggagatgaaattgttatccacaaagatatt
aatatctctattgctgttgcagacgatgataagttgtatgtgccagtcattaaaaatgca
gatgaaaaatcaattaaaggtatcgcgcgtgaaatcaatgatttagctactaaagcaaga
ttaggaaaattagcacaaagtgatatgcaaaacggtacatttacggttaataatactggt
tcttttggttctgtttcttcaatgggaatcattaatcatccacaagctgccattttacaa
gtagaatcagtcgttaagaaacctgtagttatagatgatatgattgcaattagaaatatg
gttaatttgtgtatttcaatcgatcatcgtattctcgatggtgttcaaacgggaaaattt
atgaatcttgttaagaaaaaaatagaacaatattctattgaaaacacttctatttattaa

DBGET integrated database retrieval system