KEGG   Staphylococcus epidermidis RP62A: SERP1076Help
Entry
SERP1076          CDS       T00229                                 

Definition
(GenBank) 2-oxoisovalerate dehydrogenase, E2 component, dihydrolipoamide acetyltransferase
  KO
K09699  2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [EC:2.3.1.168]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00280  Valine, leucine and isoleucine degradation
ser00640  Propanoate metabolism
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SERP1076
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SERP1076
Enzymes [BR:ser01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.168  dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
     SERP1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AAW54442
UniProt: Q5HP37
Position
complement(1120886..1122205)
Genome map
AA seq 439 aa AA seqDB search
MDIKMPKLGESVHEGTIEQWLVSVGDHVDEYEPLCEVITDKVTAEVPSTISGTITELVVE
EGQTVNINTVICKIDSENGQNQTESANEFKEEQNQHSQSNINVSQFENNPKTHESEVHTA
SSRANNNGRFSPVVFKLASEHDIDLTQVKGTGFEGRVTKKDIQNIINNPNDQEKEKEFKQ
TDKKDHSTNHCDFLHQSSTKNEHSPLSNERVVPVKGIRKAIAQNMVTSVSEIPHGWMMVE
ADATNLVQTRNYHKAQFKQNEGYNLTFFAFFVKAVAEALKVNPLLNSTWQGDEIVIHKDI
NISIAVADDDKLYVPVIKNADEKSIKGIAREINDLATKARLGKLAQSDMQNGTFTVNNTG
SFGSVSSMGIINHPQAAILQVESVVKKPVVIDDMIAIRNMVNLCISIDHRILDGVQTGKF
MNLVKKKIEQYSIENTSIY
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
ttggatataaaaatgcctaagcttggtgaaagtgtgcatgaaggtacgattgaacaatgg
ttagtatcagtaggagatcatgtagatgagtatgaaccattatgtgaagttattacagat
aaagtaacagctgaagtgccttcaacaatttctggaacaataacagaattagtggttgaa
gaaggacaaactgtcaatattaacacggtgatttgtaaaatcgattcggaaaatggtcaa
aatcaaacagaatcggcaaatgagtttaaggaagaacaaaatcagcattctcaatcaaat
ataaacgtgtcacaattcgaaaataatcctaaaactcatgaaagtgaggtgcatacagcc
tctagtcgcgcaaataacaatggacgattttcaccagttgtctttaaattagcttctgaa
catgatattgatttaacacaagtcaaaggaactggttttgaaggtcgtgttactaagaaa
gatattcaaaatattattaacaatccaaacgatcaagaaaaagagaaagaatttaaacaa
acagataaaaaagatcattcaacgaaccattgtgactttttacatcaatcctcaactaaa
aacgaacactcaccattatcaaatgaacgtgtcgtaccagttaaaggtattagaaaagct
atcgcacaaaatatggttactagtgtcagcgaaataccacacggttggatgatggttgaa
gctgatgcaacgaatttggttcagactagaaactatcataaagctcaatttaaacagaat
gagggttacaatttaactttctttgcgttttttgtaaaagctgttgcagaggctttaaaa
gtaaatccattactcaatagtacatggcaaggagatgaaattgttatccacaaagatatt
aatatctctattgctgttgcagacgatgataagttgtatgtgccagtcattaaaaatgca
gatgaaaaatcaattaaaggtatcgcgcgtgaaatcaatgatttagctactaaagcaaga
ttaggaaaattagcacaaagtgatatgcaaaacggtacatttacggttaataatactggt
tcttttggttctgtttcttcaatgggaatcattaatcatccacaagctgccattttacaa
gtagaatcagtcgttaagaaacctgtagttatagatgatatgattgcaattagaaatatg
gttaatttgtgtatttcaatcgatcatcgtattctcgatggtgttcaaacgggaaaattt
atgaatcttgttaagaaaaaaatagaacaatattctattgaaaacacttctatttattaa

DBGET integrated database retrieval system