KEGG   Staphylococcus epidermidis RP62A: SERP1077Help
Entry
SERP1077          CDS       T00229                                 

Definition
2-oxoisovalerate dehydrogenase E1 (EC:1.2.4.1)
Orthology
K00167  
2-oxoisovalerate dehydrogenase E1 component, beta subunit [EC:1.2.4.4]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ser00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1122218..1123201)
Genome map
AA seq 327 aa AA seqDB search
MTKLSYLEAIQNAQDLALNHFSNAFILGEDVGKKGGVFGTTKGLQSKYGDERVIDTPLAE
SNIIGTAIGAAMLGKRPIAEIQFADFILPATNQIISEAAKMRYRSNNDWNCPLTIRAPFG
GGVHGGLYHSQSVESIFASTPGLTIVIPSSPYDAKGLLLSSIESNDPVLYFEHKKAYRFL
KEEVPETYYTVPLGKADVKRPGEDITVFCYGLMVNYCLQAADILANDGIDVEVVDLRTVY
PLDKATIIERSQRTGKVLLVTEDNLEGSIMSEVSAIIAENCLFDLDAPIMRLAAPDVPSM
PFSPTLENEIMMNPEKIQDKMRELAQF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatcatacttagaagctatacaaaatgcacaagacttagcactaaatcat
tttagtaatgcatttatacttggcgaagatgtaggaaaaaagggtggcgttttcggcaca
accaaaggattacaaagtaagtatggtgatgaacgtgtaattgatacacctcttgcggaa
tcgaatattattggtactgctattggtgcagcaatgctaggtaagagacctattgccgaa
atacaatttgcagatttcattttgcctgctacaaatcaaattataagtgaagcagctaaa
atgagataccgttcaaataatgactggaattgcccactgactatcagagcaccttttggt
ggtggagttcatggtggattatatcattcacaaagtgttgaaagcatttttgcttcaact
cctggattaactattgttattccttcatcaccttatgatgctaaaggtcttctattgtcc
tctatagagtctaacgatccagtcttatactttgaacataaaaaagcatatcgttttcta
aaagaggaagttcccgaaacatattatactgtacctctaggtaaagcagatgttaaaagg
ccaggcgaggacatcactgtattttgttacggattgatggtgaattactgtttacaagct
gcagatattttggcaaatgacggcatcgatgttgaagtagtcgacttaagaacagtttat
ccactagataaagcaactatcattgaacgctctcaacgtactggtaaagttcttcttgtt
actgaagataatctagagggaagcattatgtctgaagtatctgcaattatagctgaaaac
tgtctgttcgatttagatgcgccaatcatgcgattagctgcaccggatgtcccatctatg
ccattttcaccaacattagaaaatgaaattatgatgaacccagaaaagatacaggacaaa
atgcgtgaactcgcacaattttaa

DBGET integrated database retrieval system