KEGG   Staphylococcus epidermidis RP62A: SERP1079Help
Entry
SERP1079          CDS       T00229                                 

Gene name
lpdA
Definition
(GenBank) 2-oxoisovalerate dehydrogenase, E3 component, lipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00010  Glycolysis / Gluconeogenesis
ser00020  Citrate cycle (TCA cycle)
ser00260  Glycine, serine and threonine metabolism
ser00280  Valine, leucine and isoleucine degradation
ser00620  Pyruvate metabolism
ser00630  Glyoxylate and dicarboxylate metabolism
ser00640  Propanoate metabolism
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01120  Microbial metabolism in diverse environments
ser01130  Biosynthesis of antibiotics
ser01200  Carbon metabolism
Module
ser_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ser_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ser_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP1079 (lpdA)
   00020 Citrate cycle (TCA cycle)
    SERP1079 (lpdA)
   00620 Pyruvate metabolism
    SERP1079 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    SERP1079 (lpdA)
   00640 Propanoate metabolism
    SERP1079 (lpdA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SERP1079 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    SERP1079 (lpdA)
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SERP1079 (lpdA)
Exosome [BR:ser04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SERP1079 (lpdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox AlaDh_PNT_C HI0933_like Pyr_redox_3 FAD_oxidored NAD_binding_8 GIDA DAO FAD_binding_2 3HCDH_N Lycopene_cycl FAD_binding_3 NAD_binding_7 2-Hacid_dh_C Trp_halogenase TrkA_N Thi4 UDPG_MGDP_dh_N K_oxygenase XdhC_C
Motif
Other DBs
NCBI-ProteinID: AAW54445
UniProt: Q5HP34
Position
complement(1124207..1125628)
Genome map
AA seq 473 aa AA seqDB search
MSEKQYDLVVLGGGTAGYVAAIRASQLGKKVAIVEKSLLGGTCLHKGCIPTKALLKSAEV
NHTIKNAHTFGIDVNHFKINFPKILERKDAIVKQLHEGVNQLMKHHHIDIYNGIGRIMGT
SIFSPQSGTISVEYEDGESDILPNKNVLIATGSSPQSLPFIKFDHKQILSSDDILRLNTL
PQRLAIIGGGVIGLEFASLMNDLGADVVVIEANDRVLPTESTQVASLLKEELTNRGVTFY
ENIQLTKDHFNQTDKGVTINISDEPVQFDKVLVAIGRKPNTNDIGLNNTQIKTSDAGHII
TNGYQQTEDKHIYAAGDCIGQLQLAHVGSKEAIVAVEHMFDCSPIPINYDLIPKCVYTNP
EIASIGKNLEQAKKAGIKAKSIKVPFKAIGKAIIEDVTQSKGFCEMVVNKDDDEIIGLNM
IGPHVTELINEISLLQFMNGSSLELGLTTHAHPSLSEVVMELGLKANGQAIHV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaaacaatacgatttagtcgtgttaggtggtggtacggcaggatatgtagcc
gccatcagagcttctcaattaggaaaaaaagtagcgatagtagaaaaatcactcttaggt
ggtacgtgtttacataaaggatgtatacctactaaagcacttttaaaatcggctgaagtc
aatcatactattaaaaacgcgcatacatttggaattgatgtcaatcattttaaaattaat
ttccctaaaattttagaacgtaaagatgctattgttaagcaattgcatgaaggcgtcaat
caactgatgaaacatcatcatatagatatttataacggtattggacgaattatgggaaca
tctatattttctcctcaaagcggtacaatttctgtggaatatgaagacggcgaatcagat
atactccctaataaaaatgtgcttatagctactgggtcatcaccacagtctcttccgttc
attaaatttgaccataaacaaatactatcgagtgatgatatcctaaggttaaatacacta
ccacaaagattagcaatcataggtggaggtgttattggtttagaatttgcatctctgatg
aatgatttaggtgctgatgtagtagtaatcgaagcgaatgacagagttcttcctaccgag
agcacacaagttgcgtcattgctaaaagaagaattaactaatcgaggcgttacattctac
gaaaatattcaattgaccaaagatcattttaaccaaactgataagggtgtaactattaat
atttcagatgagcccgtccaattcgataaagtacttgttgcaattggtagaaagcctaat
acaaatgatattggtttaaataacactcaaattaagacttctgatgctggtcatattata
acaaatggttatcagcaaactgaagataaacatatatacgcagcaggagattgtataggg
caattacaattggcacacgtcggttcaaaagaagctatagttgcagttgaacatatgttt
gattgttctcctatacctatcaattatgacctgataccaaaatgtgtttatacaaaccca
gaaattgcttcaattggtaaaaatttagaacaagcaaaaaaagcaggcatcaaagcaaaa
agtatcaaagttccttttaaagctataggaaaggcaataattgaggatgtaacccaatca
aaaggattttgcgagatggtagttaacaaagatgacgatgaaatcataggtcttaatatg
atagggccacatgttacagaattaataaatgaaatttcattgttacaatttatgaatggc
tcatctttagaacttggtttaacaacacatgcacatccttcattatccgaggtagtcatg
gaattaggtttaaaagctaatggtcaagcaattcatgtatag

DBGET integrated database retrieval system