KEGG   Staphylococcus epidermidis RP62A: SERP1088Help
Entry
SERP1088          CDS       T00229                                 

Gene name
accB
Definition
acetyl-CoA carboxylase, biotin carboxyl carrier protein
Orthology
K02160  
acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Carbon metabolism [PATH:ser01200]
Metabolism; Overview; Fatty acid metabolism [PATH:ser01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ser00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ser00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:ser00061]
Metabolism; Metabolism of terpenoids and polyketides; Tetracycline biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1132978..1133445)
Genome map
AA seq 155 aa AA seqDB search
MNFKEIKELIEILDQSSLTEINIEDNKGSVVNLKKEKETEIVTPQVTQQPTQPINHTHNE
TQQKPSHSSKDEQSSDNEYNTINAPMVGTFYKSPSPDEEAYVQVGDKVTNESTVCILEAM
KLFNEIQAETTGEIIEILVEDGQMVEYGQPLFKVK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaactttaaagaaataaaagaattaatcgaaattcttgatcaatctagtttaactgaa
ataaatattgaagataataaaggtagcgtagttaatttaaaaaaagaaaaagagactgaa
atagttacaccgcaagttactcaacaaccaactcaaccgataaatcatacgcataatgaa
acacaacaaaagccatcacatagctctaaagatgaacaaagtagtgataatgaatacaat
accattaatgcaccaatggttggtacattttataaatcaccttcaccagatgaagaagca
tacgttcaagttggagataaagttacgaatgaaagtactgtttgtatattagaagctatg
aaattatttaatgagattcaagccgaaacaacaggtgaaatcatagaaattttagtagaa
gacggacaaatggtagagtatggccagccgttatttaaggtgaaataa

DBGET integrated database retrieval system