KEGG   Staphylococcus epidermidis RP62A: SERP1088Help
Entry
SERP1088          CDS       T00229                                 

Gene name
accB
Definition
acetyl-CoA carboxylase, biotin carboxyl carrier protein
Orthology
K02160  
acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SERP1088 (accB)
   01212 Fatty acid metabolism
    SERP1088 (accB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SERP1088 (accB)
   00640 Propanoate metabolism
    SERP1088 (accB)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SERP1088 (accB)
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    SERP1088 (accB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1132978..1133445)
Genome map
AA seq 155 aa AA seqDB search
MNFKEIKELIEILDQSSLTEINIEDNKGSVVNLKKEKETEIVTPQVTQQPTQPINHTHNE
TQQKPSHSSKDEQSSDNEYNTINAPMVGTFYKSPSPDEEAYVQVGDKVTNESTVCILEAM
KLFNEIQAETTGEIIEILVEDGQMVEYGQPLFKVK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaactttaaagaaataaaagaattaatcgaaattcttgatcaatctagtttaactgaa
ataaatattgaagataataaaggtagcgtagttaatttaaaaaaagaaaaagagactgaa
atagttacaccgcaagttactcaacaaccaactcaaccgataaatcatacgcataatgaa
acacaacaaaagccatcacatagctctaaagatgaacaaagtagtgataatgaatacaat
accattaatgcaccaatggttggtacattttataaatcaccttcaccagatgaagaagca
tacgttcaagttggagataaagttacgaatgaaagtactgtttgtatattagaagctatg
aaattatttaatgagattcaagccgaaacaacaggtgaaatcatagaaattttagtagaa
gacggacaaatggtagagtatggccagccgttatttaaggtgaaataa

DBGET integrated database retrieval system