KEGG   Staphylococcus epidermidis RP62A: SERP1100Help
Entry
SERP1100          CDS       T00229                                 

Definition
glycine dehydrogenase subunit 2 (EC:1.4.4.2)
Orthology
K00283  
glycine dehydrogenase subunit 2 [EC:1.4.4.2]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ser01200]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ser00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1142833..1144341)
Genome map
AA seq 502 aa AA seqDB search
MISKSSPLIFERSKKDRYAYSLPQNDIENISIASLLDDKYIRKHKAEFPEVSELDLVRHY
TELSNKNFGVDTGFYPLGSCTMKYNPKINEKVARISGFSESHPLQEEEHVQGSLEIIYSL
QEELKEITGMDEVTLQPAAGAHGEWTALMIFKAYHEKNGQSHRDEVIVPDSAHGTNPASA
SFAGFKSVTVKSNQRGEVDIEDLKRVVNDNTAAIMLTNPNTLGIFEQDIIEIGKIVHEAG
GLLYYDGANLNAILDKVRPGDMGFDAVHLNLHKTFTGPHGGGGPGSGPVGVVEKLASYLP
KPMVIKDNDRYKYDNDIPNSIGRVKPFYGNFGIYLRAYTYIRSMGANGLKEVSEAAVLNA
NYIKSRLKNHFEIPFNQYCKHEFVLSGTLQKQYGVRTLDMAKRLLDFGVHPPTIYFPLNV
EEGMMIEPTETESKETLDYFIDAMIQIADETKNDPDKVLEAPHTTIIDRLDETTAARKPI
LKFEELKDEKYKEHTNIDSEDN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgattagtaaatcaagtcctttaatatttgaaagatccaaaaaagatagatatgcgtat
tcattaccacaaaatgacattgagaatatcagtattgcttcactcttagatgataagtat
attcgtaaacataaggctgaatttcccgaggtttcagaattagatttagttagacattat
accgaactatcaaataaaaatttcggggtagatactggattttacccattaggttcttgt
acgatgaaatataatcctaaaatcaatgaaaaggtagcgcgtatttctggttttagtgaa
tctcatcctttacaagaagaagaacacgttcaaggttctcttgaaattatatatagttta
caagaagaattgaaggaaattactggtatggatgaagttaccctacaacctgctgcaggt
gcacatggtgagtggactgctttaatgattttcaaagcttatcatgaaaaaaatggacaa
agccatcgtgatgaagtaatagtgcctgattcagcacatggtactaatcctgcttctgcc
tcatttgctggatttaaatcagtaactgtaaaatctaatcaacgtggggaagttgacata
gaagatttaaaaagagtagtaaacgataatacagctgcaatcatgttaactaatccaaat
acattaggtatatttgaacaggatattattgaaatagggaaaatcgttcatgaagcagga
ggtttattatattacgatggagcaaatttaaatgctattttagataaagtacgtcctggt
gatatgggctttgatgcggtacatcttaatttgcacaaaacattcactggtcctcatggc
ggtggtggaccaggatcaggaccagttggagtagtagagaaattagccagttatctacct
aagcctatggttataaaagataacgataggtataaatatgataatgatattccaaattca
attggacgagtaaaaccgttttatggaaatttcggcatttatttaagagcatatacttat
atcagatcaatgggagccaatggtttaaaagaagtatctgaagctgccgttcttaatgcg
aattatataaaatctcgccttaaaaatcactttgaaattccgttcaatcaatattgtaaa
catgaatttgtattaagtggaactttacaaaaacaatatggtgtcagaacattagatatg
gctaagcgactgttagattttggtgtgcatccacctacaatatattttcctctcaatgtc
gaagaaggaatgatgattgagccaacagaaactgaatctaaagaaacacttgattacttt
attgatgcgatgattcaaatcgctgacgaaacaaaaaatgatccagataaagttttagaa
gcaccacatacgactataattgatcgattagatgagaccactgcagcacgaaaaccaatt
cttaaatttgaagaacttaaggacgaaaagtataaagaacacacaaatattgattctgaa
gataattaa

DBGET integrated database retrieval system