KEGG   Staphylococcus epidermidis RP62A: SERP1100Help
Entry
SERP1100          CDS       T00229                                 

Definition
glycine dehydrogenase subunit 2 (EC:1.4.4.2)
Orthology
K00283  
glycine dehydrogenase subunit 2 [EC:1.4.4.2]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SERP1100
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SERP1100
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     SERP1100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1142833..1144341)
Genome map
AA seq 502 aa AA seqDB search
MISKSSPLIFERSKKDRYAYSLPQNDIENISIASLLDDKYIRKHKAEFPEVSELDLVRHY
TELSNKNFGVDTGFYPLGSCTMKYNPKINEKVARISGFSESHPLQEEEHVQGSLEIIYSL
QEELKEITGMDEVTLQPAAGAHGEWTALMIFKAYHEKNGQSHRDEVIVPDSAHGTNPASA
SFAGFKSVTVKSNQRGEVDIEDLKRVVNDNTAAIMLTNPNTLGIFEQDIIEIGKIVHEAG
GLLYYDGANLNAILDKVRPGDMGFDAVHLNLHKTFTGPHGGGGPGSGPVGVVEKLASYLP
KPMVIKDNDRYKYDNDIPNSIGRVKPFYGNFGIYLRAYTYIRSMGANGLKEVSEAAVLNA
NYIKSRLKNHFEIPFNQYCKHEFVLSGTLQKQYGVRTLDMAKRLLDFGVHPPTIYFPLNV
EEGMMIEPTETESKETLDYFIDAMIQIADETKNDPDKVLEAPHTTIIDRLDETTAARKPI
LKFEELKDEKYKEHTNIDSEDN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgattagtaaatcaagtcctttaatatttgaaagatccaaaaaagatagatatgcgtat
tcattaccacaaaatgacattgagaatatcagtattgcttcactcttagatgataagtat
attcgtaaacataaggctgaatttcccgaggtttcagaattagatttagttagacattat
accgaactatcaaataaaaatttcggggtagatactggattttacccattaggttcttgt
acgatgaaatataatcctaaaatcaatgaaaaggtagcgcgtatttctggttttagtgaa
tctcatcctttacaagaagaagaacacgttcaaggttctcttgaaattatatatagttta
caagaagaattgaaggaaattactggtatggatgaagttaccctacaacctgctgcaggt
gcacatggtgagtggactgctttaatgattttcaaagcttatcatgaaaaaaatggacaa
agccatcgtgatgaagtaatagtgcctgattcagcacatggtactaatcctgcttctgcc
tcatttgctggatttaaatcagtaactgtaaaatctaatcaacgtggggaagttgacata
gaagatttaaaaagagtagtaaacgataatacagctgcaatcatgttaactaatccaaat
acattaggtatatttgaacaggatattattgaaatagggaaaatcgttcatgaagcagga
ggtttattatattacgatggagcaaatttaaatgctattttagataaagtacgtcctggt
gatatgggctttgatgcggtacatcttaatttgcacaaaacattcactggtcctcatggc
ggtggtggaccaggatcaggaccagttggagtagtagagaaattagccagttatctacct
aagcctatggttataaaagataacgataggtataaatatgataatgatattccaaattca
attggacgagtaaaaccgttttatggaaatttcggcatttatttaagagcatatacttat
atcagatcaatgggagccaatggtttaaaagaagtatctgaagctgccgttcttaatgcg
aattatataaaatctcgccttaaaaatcactttgaaattccgttcaatcaatattgtaaa
catgaatttgtattaagtggaactttacaaaaacaatatggtgtcagaacattagatatg
gctaagcgactgttagattttggtgtgcatccacctacaatatattttcctctcaatgtc
gaagaaggaatgatgattgagccaacagaaactgaatctaaagaaacacttgattacttt
attgatgcgatgattcaaatcgctgacgaaacaaaaaatgatccagataaagttttagaa
gcaccacatacgactataattgatcgattagatgagaccactgcagcacgaaaaccaatt
cttaaatttgaagaacttaaggacgaaaagtataaagaacacacaaatattgattctgaa
gataattaa

DBGET integrated database retrieval system