KEGG   Staphylococcus epidermidis RP62A: SERP1117Help
Entry
SERP1117          CDS       T00229                                 

Gene name
pbp3
Definition
penicillin-binding protein 3
Orthology
K12553  
penicillin-binding protein 3 [EC:3.4.-.-]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SERP1117 (pbp3)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SERP1117 (pbp3)
Enzymes [BR:ser01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     SERP1117 (pbp3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1155781..1157871)
Genome map
AA seq 696 aa AA seqDB search
MLKRLKEKSNDEKMRNTMNKRINFIFGFIVFIFAIVVLRLGYLQIAQGSHYKQLIKNDEN
ITVNESVPRGRILDRNGKVLVDNASKMSITYTRNRKTSQKEMLNTAKKLTDLIKMDTDKI
TERDKKDFWIQMYPSSAKKLMRKEQLMLEDGSISQDQFDTQLRDKIGKKQLKQLTKKDLQ
VLAIYREMNAGSTLDPQTIKNEDVSEKEYAAVSQQLSKLPGVNTTMDWDRKYPYGDTLRG
IFGDVSTSTEGIPKELTEQYLSKGYSRNDRVGKSYLEYQYEDVLKGTKKQMKYTTDKSGR
VISSEVLNPGSRGHDLQLTIDIDLQKKVESLLEKQISKLRSQGAKDMDNALMVVQNPKNG
DILAIAGKQIDKQGKLKDYDIGNFTAQYTVGSSVKGGTLLAGYQNKAINVGETMVDEPLK
FQGGLTKRSYFNKNGHVSIDDKQALMHSSNVYMFKTALKLAGDPYTSGMSLPNNIADAGR
KLRKGLNQVGLGLKTGIDLPNETPGQIEPLTNNPGNYLDLAIGQYDTYTPLQLSQYVSTI
ANDGYRIQPHIGLSIYESTNKDETGPLKRKIKGNVLNKVNNSNDEIKEVQEGFKMAFNEK
QGTGYASFRNTVVPSAGKTGTAEVFQDGEPRVNSTYIGYAPVDDPKLSFSIVYTNQPVPP
PWLNGGDLGRDVINYYFKDKDNKKDDSQSNNEEKED
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
ttgctaaaaagattaaaagaaaaatcaaatgatgaaaaaatgagaaacaccatgaataaa
agaatcaatttcatatttggatttatagtatttatctttgctatagtcgtattgagatta
ggttatttacaaatagcacaaggatctcattacaaacaattaatcaaaaacgatgaaaac
ataactgttaatgaatcagtaccaagaggccgaatactagatagaaatggcaaagtacta
gttgataatgcttcaaagatgtctattacatacactagaaaccgtaaaacatcacaaaag
gaaatgttaaatactgctaagaaactgacagatttaattaaaatggatacagataaaatt
actgagagagataaaaaggatttttggattcaaatgtatccgtcatctgctaaaaagtta
atgagaaaagaacaattaatgttagaggatggcagtatttcacaagaccaatttgatacc
caacttagagataaaataggaaaaaaacaattaaaacagttaactaaaaaagatttgcaa
gttttagcaatttatcgggaaatgaacgctgggtcaactctagatcctcaaacaattaaa
aatgaagacgtaagcgagaaagaatatgcagccgtatcacaacagctttctaaattacct
ggtgtaaatactacaatggattgggatagaaaatacccatacggtgatactttaagaggc
atatttggagatgtgtcgacttcgactgaaggtatacctaaagaattaactgaacaatat
ttatcaaaaggttattcacgaaatgatcgggtcggtaaatcttatcttgaatatcaatac
gaagatgttcttaaaggcacgaagaaacaaatgaaatatacaactgataaatctggaaga
gtaataagttcagaagtacttaatcctggctcaagaggtcatgatttacaattaactata
gatattgatttacagaaaaaagtagaatctttattagaaaaacaaatttctaaattacgt
agtcaaggtgctaaggatatggacaatgcgttaatggttgtccaaaatcctaaaaatgga
gacattctcgctattgcaggaaagcaaattgataagcaaggtaaactcaaagattatgat
atcggcaactttacagctcaatacacagtaggttcttcagtaaaaggaggaacattatta
gctggataccaaaataaagctattaatgttggagaaactatggtagatgagccattaaaa
ttccaaggtggtttaactaagcgttcttattttaataaaaatggtcatgtatctatcgat
gataaacaagcacttatgcattcatcaaacgtatacatgtttaaaaccgcacttaaatta
gcaggtgacccctatacttcaggtatgtcattacctaataatatagcagatgctggtcgt
aaattgcgtaaagggttaaatcaagtaggtcttggcttaaaaacaggtattgacttaccg
aacgaaacgccaggccaaatagaacccttaactaataatcctggtaactatttagactta
gctattggacaatacgacacatatacaccacttcagttgtcccaatacgtatcaactatt
gctaatgatggctatagaattcaaccacatattggattgtctatttatgaatctactaat
aaagatgaaactggtccattaaaacgtaaaattaagggtaatgttttaaataaggtaaat
aactcaaatgacgaaattaaagaagttcaagaaggcttcaaaatggctttcaatgaaaag
caaggtacaggttatgctagttttagaaatactgtagtaccttcagctggtaaaacagga
actgctgaagtttttcaagacggagaacctagagttaactcaacatatatcggttatgca
cccgtcgatgatcctaaattatctttttcaattgtctatacaaatcaacctgttccacca
ccttggttaaatggtggagatttaggtagagacgtaatcaactactattttaaagataag
gataataaaaaagatgactctcaatctaataacgaagagaaagaagattaa

DBGET integrated database retrieval system