KEGG   Staphylococcus epidermidis RP62A: SERP1237Help
Entry
SERP1237          CDS       T00229                                 

Definition
(GenBank) GTP-binding protein, EngB family
  KO
K03978  GTP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Chromosome and associated proteins [BR:ser03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    SERP1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMR_HSR1 FeoB_N Dynamin_N RsgA_GTPase AIG1 Septin IIGP GTP_EFTU USP7_ICP0_bdg cobW RNA_helicase ABC_tran AAA_29 RB_B
Motif
Other DBs
NCBI-ProteinID: AAW54594
UniProt: Q5HNN0
Position
complement(1272611..1273198)
Genome map
AA seq 195 aa AA seqDB search
MNINFNNINLIISAVKKAQYPDTGLTEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGK
TQTLNFYNIDEQLIFVDVPGYGYAKVSKVQREKFGKMIEEYITQRENLKLVIQLVDLRHQ
PTEDDVLMYNYLKHFDIPTLVICTKEDKIAKGKVQKHIKRIKDKLELESGDNIISYSSIK
NSKQQEIWNFIETYI
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaattttaataatattaacttaattataagtgctgtaaaaaaagcacagtat
cctgacactggattaacagaagtagcgttaagtggacgctcaaatgtagggaaatctaca
tttattaatagtatgattgggcgtaaaaatatggcgagaacgtcacaacaacctggtaag
acacagacattgaatttctataatatagatgaacaacttatttttgttgatgtaccagga
tatggatacgctaaagtaagtaaagttcaacgagaaaaatttggtaaaatgattgaagaa
tatattacacaacgagagaatttaaaacttgttattcaacttgtcgatttaagacatcaa
cctactgaagatgatgtgcttatgtacaattatcttaaacattttgatataccaacactt
gtaatatgtactaaagaagataaaattgccaaaggaaaagtacaaaagcatatcaaaaga
ataaaagacaaattagaattagaatctggagataatattataagttattcttcaattaaa
aatagtaaacagcaagaaatttggaactttattgaaacatatatataa

DBGET integrated database retrieval system