KEGG   Staphylococcus epidermidis RP62A: SERP1237Help
Entry
SERP1237          CDS       T00229                                 

Definition
(GenBank) GTP-binding protein, EngB family
  KO
K03978  
GTP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Chromosome [BR:ser03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    SERP1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1272611..1273198)
Genome map
AA seq 195 aa AA seqDB search
MNINFNNINLIISAVKKAQYPDTGLTEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGK
TQTLNFYNIDEQLIFVDVPGYGYAKVSKVQREKFGKMIEEYITQRENLKLVIQLVDLRHQ
PTEDDVLMYNYLKHFDIPTLVICTKEDKIAKGKVQKHIKRIKDKLELESGDNIISYSSIK
NSKQQEIWNFIETYI
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaattttaataatattaacttaattataagtgctgtaaaaaaagcacagtat
cctgacactggattaacagaagtagcgttaagtggacgctcaaatgtagggaaatctaca
tttattaatagtatgattgggcgtaaaaatatggcgagaacgtcacaacaacctggtaag
acacagacattgaatttctataatatagatgaacaacttatttttgttgatgtaccagga
tatggatacgctaaagtaagtaaagttcaacgagaaaaatttggtaaaatgattgaagaa
tatattacacaacgagagaatttaaaacttgttattcaacttgtcgatttaagacatcaa
cctactgaagatgatgtgcttatgtacaattatcttaaacattttgatataccaacactt
gtaatatgtactaaagaagataaaattgccaaaggaaaagtacaaaagcatatcaaaaga
ataaaagacaaattagaattagaatctggagataatattataagttattcttcaattaaa
aatagtaaacagcaagaaatttggaactttattgaaacatatatataa

DBGET integrated database retrieval system