KEGG   Staphylococcus epidermidis RP62A: SERP1246Help
Entry
SERP1246          CDS       T00229                                 

Gene name
thrS
Definition
threonyl-tRNA synthetase (EC:6.1.1.3)
Orthology
K01868  
threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:ser00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1281592..1283529)
Genome map
AA seq 645 aa AA seqDB search
MNQINIQFPDGNTKEFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTRPLEQDGAIE
IITPGSEEALEVLRHSTAHLMAQALKRLYGDVKFGVGPVIEGGFYYDFDMDDKVSSDDFD
KIEKTMKQIVNENHKIVREVVSKEKAKDFFKDDPYKLELIDAIPEDESVTLYTQGEFTDL
CRGVHVPSTSKIKEFKLLSTAGAYWRGNSDNKMLQRIYGTAFFDKKDLKAHLKMLEERRE
RDHRKIGKDLELFTNNQLVGAGLPLWLPNGATIRREIERYIVDKEVSMGYDHVYTPVLAN
VDLYKTSGHWDHYQEDMFPAMKLDEDEAMVLRPMNCPHHMMIYKNKPHSYRELPIRIAEL
GTMHRYEASGAVSGLQRVRGMTLNDSHIFVRPDQIKEEFKRVVNMIQDVYKDFGFEDYRF
RLSYRDPEDKHKYFDDDEMWEKAESMLKEASDELGLTYEEAIGEAAFYGPKLDVQVKTAM
GKEETLSTAQLDFLLPERFDLTYIGQDGEQHRPVVIHRGVVSTMERFVAFLTEETKGAFP
TWLAPMQVEIIPVNIDLHYDYARLLQDELKSQGVRVEIDDRNEKMGYKIREAQMKKIPYQ
IVVGDQEVENQEVNVRKYGSEKQESVEKDEFIWNVIDEIRLKKHR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaattaatattcaatttccagatggtaatacaaaagaatttgataaagggact
actacagaagacatcgctcaatcaattagtccaggattaagaaaaaaagcagttgcggga
aaattcaatggtcaacttgtagatttaacacgccctttagaacaagatggagctattgaa
attattactcctgggagtgaagaagcgttagaagtacttcgtcattcaacagctcattta
atggcacaagcattaaaacgtttatacggagacgttaaatttggagttggacctgtaata
gaaggcggattctattatgattttgatatggatgataaggtttcatcggatgattttgat
aaaattgagaaaacaatgaaacaaattgtgaacgaaaatcataaaattgtaagagaagta
gttagtaaagaaaaagcaaaagacttcttcaaggatgacccttataaattagaacttatt
gatgcaattcctgaagatgagagtgtaacactttatactcaaggtgaatttactgattta
tgtcgaggtgtacacgtaccttctacttctaaaattaaagagttcaaactattatctaca
gctggtgcttattggcgtggaaatagtgataataaaatgttacaacgaatttatggtaca
gcattctttgacaaaaaagatttgaaagcacatctaaaaatgttggaagaacgtcgtgag
cgtgatcatcgtaaaattggtaaagatttagaattgtttacaaacaatcaactcgttggt
gctggtttaccattatggttaccaaatggtgctacaatacgtagggaaatagaacgttat
attgtcgataaagaagtaagtatgggatacgatcatgtttacacaccagtattagccaat
gttgatttatataaaacatctggtcactgggatcattatcaagaagatatgttcccagca
atgaagttagatgaagacgaagcaatggtcttaagaccaatgaactgtccacatcatatg
atgatttataaaaacaaacctcattcttatcgcgaattacctatacgtattgctgaattg
ggtactatgcatcgttacgaagcaagtggtgcagtatcaggtttacaacgtgttcgagga
atgacattgaatgattcccatattttcgttagacctgatcaaattaaagaagaatttaaa
cgtgtagttaatatgattcaagatgtgtacaaagattttggttttgaagattatcgcttc
agattgagttatagagatcctgaagataagcataagtactttgatgatgatgaaatgtgg
gaaaaagctgaatccatgcttaaagaagcatcagatgaattaggtttaacttatgaagaa
gctattggtgaggcagcattctatggacctaagttagatgttcaagtaaaaacagctatg
ggaaaagaagaaactctatcaacagcacaacttgattttcttttaccagaacgttttgac
ttaacgtacattggtcaagatggagaacaacatcgtcctgtagttatacaccgtggtgta
gtttctactatggaacgttttgttgcatttttaacagaagaaacaaaaggtgcatttcca
acttggttggcgcctatgcaagttgaaattattcctgtaaatatagatttacattatgat
tatgcaagacttttacaagatgaactaaaatcgcaaggtgtccgcgttgaaattgatgac
cgtaatgaaaaaatgggatataaaattcgtgaagctcaaatgaaaaaaataccttatcag
attgttgtaggtgaccaagaagtagagaatcaagaagtaaatgtaagaaaatatggttct
gaaaaacaagaatcagttgaaaaagatgaatttatttggaatgttattgatgaaatccgt
ttgaaaaagcatagataa

DBGET integrated database retrieval system