KEGG   Staphylococcus epidermidis RP62A: SERP1255Help
Entry
SERP1255          CDS       T00229                                 

Gene name
phoR
Definition
sensory box histidine kinase PhoR
Orthology
K07636  
two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Two-component system
Module
PhoR-PhoB (phosphate starvation response) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ser02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1293472..1295169)
Genome map
AA seq 565 aa AA seqDB search
MLKFHLRLLLLISTITIISFIGLGAIIHNTIYQTLTSNQIKSLDSEARNYVNLFNNNKEK
EITNIAHNEKNIILIKEKDKDKIIYSSGNIKDIDHRIDNEANPSKLINKNTKLGMRYTYK
NTIDDKTIYISGINNEIIDLQKDLWKYLSIVGVIVLFTVYLASRSINRTYIRPINEVTYA
TSLLADGYYHVRVPESNVKETRALFVTTNDLARRLQKLNNSQKIQSNRLKTTLENIPSSV
LMIDKHGEIVVANHAYYQVFNPDQMVENKSYIGFIDDSIEKLIIESFRTEKVIYEQLEVA
INNVHTKYFDVSCIPILTKSKKNLQGMVVVLHDITNLQKLENLRREFVANVSHELKTPIT
SIKGFAETLIEGAKNDEQSLDMFLNIILKESNRIESLVTDLLDLSHIEQQKELEINYMNL
SELAINIIDNLQTQAYNKRIKIQSEIEKDVIIEAHENKIAQVITNLLSNAINYSSEDNKV
IVRVYRNDNKVYLEIQDYGIGISETDQKRIFERFYRVDKARSRDSGGTGLGLSITKHIVE
AHNGRIGVKSAPGKGSIFKVLFNDN
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagttccatttgcgtttattactattaattagtactattacaatcattagtttt
attggtttaggcgctatcattcacaacacaatttatcaaacattaactagtaatcaaatt
aaaagcttagatagtgaagcccgtaattatgttaatctctttaataataataaagagaaa
gaaatcactaatatagctcataatgaaaaaaatatcatattaataaaagaaaaagataaa
gataaaattatttactcaagtggaaatattaaagatattgaccatagaattgataatgaa
gctaatccttcgaaattaatcaataaaaacacaaaactcggtatgcgttacacctataag
aatacaatagatgataaaacaatatacataagtggaattaataatgaaattattgattta
caaaaagatttatggaaatacttgtctattgttggagtcattgtattatttacggtttat
ttagcaagtagaagtatcaatcgaacatatattagacctatcaatgaagtaacttatgct
acatcacttctagcagatggatattaccatgttcgtgttccagaaagtaatgtgaaggaa
actagggcattatttgtgactacaaatgacttagcacgacgattgcaaaaattaaacaat
agtcaaaaaattcaatccaatagattaaaaactaccttagaaaatataccgagttcagta
ctgatgattgataaacatggagaaattgtagttgctaatcatgcttattatcaggtgttt
aaccctgatcaaatggtagaaaataaaagttacattggtttcatagatgatagtattgaa
aaattaattattgaaagttttagaactgaaaaagttatctatgaacaattagaagttgct
attaataacgtacatactaaatatttcgatgtatcttgtatccccattttaactaaatct
aaaaaaaatttacaaggtatggtggttgtgcttcatgacattactaatttgcagaaatta
gaaaaccttagaagggaatttgttgcaaatgtgtcacatgaactaaaaacaccgattact
tcaatcaaaggttttgcagaaactctgattgaaggtgctaaaaatgatgaacaatcgctt
gatatgtttttaaatattattttaaaagaatctaatagaatagagtcattggttacagac
ttattagatttatcacatatagaacagcaaaaagaacttgaaataaattacatgaattta
tctgaattagctattaatataatagataatttgcaaacacaagcatacaataagagaatc
aaaatacaatctgaaattgaaaaagatgtcatcattgaggcacatgaaaataaaatagcg
caagttattactaatttgctatcaaatgctataaattattcttcagaagataataaggta
atagtaagagtatatagaaatgacaataaagtttatttagagattcaagattatggtatt
ggtataagtgaaacagatcaaaagcgtatatttgaacgtttctatcgtgtagataaagcg
agaagtagagattcaggtggtacaggacttggtctgtctataacaaaacatattgttgaa
gcacataatggtagaataggcgtgaaaagtgcacctggcaaaggttcgatattcaaagtt
ctatttaatgataattaa

DBGET integrated database retrieval system