KEGG   Staphylococcus epidermidis RP62A: SERP1256Help
Entry
SERP1256          CDS       T00229                                 

Gene name
phoP
Definition
alkaline phosphatase synthesis transcriptional regulatory protein PhoP
Orthology
K07658  
two-component system, OmpR family, alkaline phosphatase synthesis response regulator PhoP
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Two-component system
Module
PhoR-PhoB (phosphate starvation response) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SERP1256 (phoP)
Two-component system [BR:ser02022]
 OmpR family
  PhoR-PhoB (phosphate) [MD:M00434]
   SERP1256 (phoP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1295169..1295879)
Genome map
AA seq 236 aa AA seqDB search
MSQKILVVDDEQSIVTLLKYNLETAGYIVEVAYDGEEALKKVETEQPELIVLDVMLPKKD
GIEVCKTIRSDKNLVPILMLTAKDDEFDRVLGLELGADDYMTKPFSPREVVARVKAILRR
SQFVNEIEKEDVDDEDIIIGSIRIRPEFFEVYKEDELLELTPKEFELLLYLIERQGRVIT
REHMLNSVWNYEFAGDSRIVDVHISHLRDKLEENPKQPKLIKTVRGLGYKLERPKA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaaaaatattagtggttgatgatgagcaatccatcgtgaccttactaaaatat
aatttagaaacagcagggtatatagtcgaagtcgcttatgatggtgaagaggcattgaaa
aaagttgaaacagaacaaccggaactaattgtattagacgttatgttgccaaaaaaagat
ggtatagaagtatgtaaaacaatcaggtctgataaaaatttagtaccgattttaatgttg
acagcaaaggacgatgaatttgatcgagttttagggcttgaactaggtgctgatgactat
atgacaaaaccattttcacctagagaggtagttgccagagttaaagcaatattaagacgt
tctcaatttgtaaatgaaattgagaaggaagatgttgatgatgaagatattatcattggt
tcaattagaattcgacctgaattctttgaagtctataaagaagatgaattattagaattg
acgccaaaagaatttgaattgttattatatttaattgaaagacaaggaagagttattact
cgagaacatatgttgaattcagtgtggaattatgaattcgctggagattctcgaattgtt
gatgtacatataagccacttaagagataaattggaagaaaatcctaagcaacctaaattg
ataaagactgtacgtggtttaggttataaactggagagacctaaagcttaa

DBGET integrated database retrieval system