KEGG   Staphylococcus epidermidis RP62A: SERP1267Help
Entry
SERP1267          CDS       T00229                                 

Definition
DHH family protein
Orthology
K06881  
phosphoesterase RecJ domain-containing protein
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1311627..1312565)
Genome map
AA seq 312 aa AA seqDB search
MEVKMNEIMEALEQSELIIIHRHLRPDPDAYGSQLGLKYYLQKKFPNKQIYAVGANEDSL
KFIGLMDEIDNDIYKKATVVVCDTANAPRIDDQRYDTGTKLLKIDHHPATDQYGDINYVN
TKASSTSEIIYEFISHFNDEHIIDEQVARVLYLGIVGDTGRFLFNNTTPRTMQIAGKLLT
YPFDHNQELNKMSEKDPKLLPFQGYILQNFDLNDKGFCKVKITKDILEKFQIQPNEASLF
VNTIADIRGLKIWMFGVDEGDQIRCRLRSKGHIIINDVANTFGGGGHPNASGVSVNSWEQ
FEQLAEALNDKL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaaaaatgaatgaaataatggaagcattagaacaaagtgaattaattattatt
cacagacatctaagacccgatccagacgcatatggttcacaattaggtttgaaatattac
ttacaaaagaagtttccaaacaaacaaatttatgctgtaggagctaatgaagattctttg
aaatttataggtttgatggacgaaattgacaatgatatatacaagaaagcgactgtagtt
gtatgtgatacggcaaatgcgccacgaatagatgaccaacgttatgatacaggtaccaaa
cttttgaaaattgatcatcatcctgctactgatcagtatggagatattaactatgttaat
accaaagcttcttccactagtgaaataatttacgaattcatttcacatttcaatgatgaa
catatcattgatgaacaagttgctagagtattatatcttggcatcgttggtgatactgga
cgttttttatttaataatacaacgccacgaacaatgcaaattgctggaaaattacttaca
tatccttttgatcacaaccaagaattaaacaaaatgtctgaaaaggatccaaaactatta
ccatttcaaggatatatattgcaaaattttgatttaaatgataaaggattttgcaaagtt
aaaataactaaagacatacttgaaaaatttcaaatacaacctaatgaagcgtctttattt
gtaaatacaatcgcagatattcgaggattaaaaatatggatgtttggcgttgatgaagga
gatcaaattagatgtcggttgcgttctaaaggtcatattattattaatgatgtcgctaat
acatttggtggtggtggacatccaaatgcatctggagtttcagtaaatagttgggagcaa
ttcgagcaactcgccgaagctttaaacgacaagttataa

DBGET integrated database retrieval system