KEGG   Staphylococcus epidermidis RP62A: SERP1267Help
Entry
SERP1267          CDS       T00229                                 

Definition
(RefSeq) DHH family protein
  KO
K06881  
bifunctional oligoribonuclease and PAP phosphatase NrnA [EC:3.1.3.7 3.1.13.3]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SERP1267
Enzymes [BR:ser01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SERP1267
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.3  oligonucleotidase
     SERP1267
DNA repair and recombination proteins [BR:ser03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Others
    SERP1267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1311627..1312565)
Genome map
AA seq 312 aa AA seqDB search
MEVKMNEIMEALEQSELIIIHRHLRPDPDAYGSQLGLKYYLQKKFPNKQIYAVGANEDSL
KFIGLMDEIDNDIYKKATVVVCDTANAPRIDDQRYDTGTKLLKIDHHPATDQYGDINYVN
TKASSTSEIIYEFISHFNDEHIIDEQVARVLYLGIVGDTGRFLFNNTTPRTMQIAGKLLT
YPFDHNQELNKMSEKDPKLLPFQGYILQNFDLNDKGFCKVKITKDILEKFQIQPNEASLF
VNTIADIRGLKIWMFGVDEGDQIRCRLRSKGHIIINDVANTFGGGGHPNASGVSVNSWEQ
FEQLAEALNDKL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaaaaatgaatgaaataatggaagcattagaacaaagtgaattaattattatt
cacagacatctaagacccgatccagacgcatatggttcacaattaggtttgaaatattac
ttacaaaagaagtttccaaacaaacaaatttatgctgtaggagctaatgaagattctttg
aaatttataggtttgatggacgaaattgacaatgatatatacaagaaagcgactgtagtt
gtatgtgatacggcaaatgcgccacgaatagatgaccaacgttatgatacaggtaccaaa
cttttgaaaattgatcatcatcctgctactgatcagtatggagatattaactatgttaat
accaaagcttcttccactagtgaaataatttacgaattcatttcacatttcaatgatgaa
catatcattgatgaacaagttgctagagtattatatcttggcatcgttggtgatactgga
cgttttttatttaataatacaacgccacgaacaatgcaaattgctggaaaattacttaca
tatccttttgatcacaaccaagaattaaacaaaatgtctgaaaaggatccaaaactatta
ccatttcaaggatatatattgcaaaattttgatttaaatgataaaggattttgcaaagtt
aaaataactaaagacatacttgaaaaatttcaaatacaacctaatgaagcgtctttattt
gtaaatacaatcgcagatattcgaggattaaaaatatggatgtttggcgttgatgaagga
gatcaaattagatgtcggttgcgttctaaaggtcatattattattaatgatgtcgctaat
acatttggtggtggtggacatccaaatgcatctggagtttcagtaaatagttgggagcaa
ttcgagcaactcgccgaagctttaaacgacaagttataa

DBGET integrated database retrieval system