KEGG   Staphylococcus epidermidis RP62A: SERP1280Help
Entry
SERP1280          CDS       T00229                                 

Definition
aminotransferase class V
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SERP1280
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    SERP1280
Enzymes [BR:ser01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     SERP1280
Transfer RNA biogenesis [BR:ser03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    SERP1280
 Prokaryotic Type
    SERP1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1324368..1325507)
Genome map
AA seq 379 aa AA seqDB search
MIYLDNAATTKADQDVVDSFVKVNQTLYFNPNSPHHAGVQAEQLLLKAKSEINRILNLNN
QFDIIFTSGATESNNILLKGIAYMKKETANEIITSVLEHPSVLEVMRYLEREKGFKLKYV
DVTKEGKLDTEHLKSLMTDKVGLVTCMYVNNIMGQIQPIEEIANIVKNYPRAHFHVDAVQ
ALGKVPMQINHIDSLSLSGHKFNGLKGQGLLLLKNIQNIEPIVHGGGQEYGLRSGTINLP
MAISMVRAIKNAVDQTKELNLRLSNYKNKLLSFLAEYKNVFINSPQNASPHIINIGFPGV
KGEVLVNAFSKQNVMVSTTSACSSKMNKLNEVLLAMEIAESKIEGSIRISLGAHTTENDI
LSFMNAFESVYKEIKELLK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgatttatttagacaatgcagccactaccaaagctgatcaagatgttgttgattcattc
gtgaaagtgaaccaaacattatacttcaatccaaatagtcctcatcatgcaggggttcaa
gctgaacaattattattaaaagcaaaaagtgaaatcaatcgtatattaaacttaaataat
cagtttgatatcatttttacaagtggcgcaactgaatcgaataatatactgctaaaaggt
attgcgtatatgaaaaaagaaactgctaatgagattatcacatcagtcttagaacatcct
tcagttttggaagtaatgaggtatttggaaagggaaaaaggttttaaattaaaatacgtt
gatgtgacaaaagaaggtaagttggacacagaacacttaaaatcattaatgacagataaa
gtaggacttgtgacatgtatgtatgtcaataatattatgggacaaattcaacctattgaa
gaaatagcaaatattgtaaaaaattacccacgtgcacactttcatgttgatgcagtccag
gctttaggtaaagtgcctatgcaaattaatcatattgatagtttgagtttaagtggtcat
aagtttaatggacttaaaggtcagggactactacttttaaaaaatattcaaaacatagaa
cctatagtacatggtggtgggcaagaatatgggctacgaagtggtacaattaatctacca
atggctatctctatggttagagctataaagaatgcagttgatcaaacaaaagagcttaat
ttacgtttaagcaattataaaaataaattactttcatttttagcagaatacaaaaatgta
tttatcaactctcctcaaaatgcatcacctcatattataaatataggatttccaggtgtt
aagggtgaggtacttgttaatgctttttccaaacaaaacgtaatggtttcaactacaagc
gcttgttcttctaagatgaataaattgaatgaggttttacttgcaatggaaattgcagag
tcaaaaatagaaggtagtataagaatttctttaggggcacatacgactgaaaacgatata
ttaagttttatgaatgcatttgaatctgtatataaggaaattaaggagctgttaaagtaa

DBGET integrated database retrieval system