KEGG   Staphylococcus epidermidis RP62A: SERP1280Help
Entry
SERP1280          CDS       T00229                                 

Definition
aminotransferase class V
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Thiamine metabolism
Sulfur relay system
Class
Metabolism; Metabolism of cofactors and vitamins; Thiamine metabolism [PATH:ser00730]
Genetic Information Processing; Folding, sorting and degradation; Sulfur relay system [PATH:ser04122]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1324368..1325507)
Genome map
AA seq 379 aa AA seqDB search
MIYLDNAATTKADQDVVDSFVKVNQTLYFNPNSPHHAGVQAEQLLLKAKSEINRILNLNN
QFDIIFTSGATESNNILLKGIAYMKKETANEIITSVLEHPSVLEVMRYLEREKGFKLKYV
DVTKEGKLDTEHLKSLMTDKVGLVTCMYVNNIMGQIQPIEEIANIVKNYPRAHFHVDAVQ
ALGKVPMQINHIDSLSLSGHKFNGLKGQGLLLLKNIQNIEPIVHGGGQEYGLRSGTINLP
MAISMVRAIKNAVDQTKELNLRLSNYKNKLLSFLAEYKNVFINSPQNASPHIINIGFPGV
KGEVLVNAFSKQNVMVSTTSACSSKMNKLNEVLLAMEIAESKIEGSIRISLGAHTTENDI
LSFMNAFESVYKEIKELLK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgatttatttagacaatgcagccactaccaaagctgatcaagatgttgttgattcattc
gtgaaagtgaaccaaacattatacttcaatccaaatagtcctcatcatgcaggggttcaa
gctgaacaattattattaaaagcaaaaagtgaaatcaatcgtatattaaacttaaataat
cagtttgatatcatttttacaagtggcgcaactgaatcgaataatatactgctaaaaggt
attgcgtatatgaaaaaagaaactgctaatgagattatcacatcagtcttagaacatcct
tcagttttggaagtaatgaggtatttggaaagggaaaaaggttttaaattaaaatacgtt
gatgtgacaaaagaaggtaagttggacacagaacacttaaaatcattaatgacagataaa
gtaggacttgtgacatgtatgtatgtcaataatattatgggacaaattcaacctattgaa
gaaatagcaaatattgtaaaaaattacccacgtgcacactttcatgttgatgcagtccag
gctttaggtaaagtgcctatgcaaattaatcatattgatagtttgagtttaagtggtcat
aagtttaatggacttaaaggtcagggactactacttttaaaaaatattcaaaacatagaa
cctatagtacatggtggtgggcaagaatatgggctacgaagtggtacaattaatctacca
atggctatctctatggttagagctataaagaatgcagttgatcaaacaaaagagcttaat
ttacgtttaagcaattataaaaataaattactttcatttttagcagaatacaaaaatgta
tttatcaactctcctcaaaatgcatcacctcatattataaatataggatttccaggtgtt
aagggtgaggtacttgttaatgctttttccaaacaaaacgtaatggtttcaactacaagc
gcttgttcttctaagatgaataaattgaatgaggttttacttgcaatggaaattgcagag
tcaaaaatagaaggtagtataagaatttctttaggggcacatacgactgaaaacgatata
ttaagttttatgaatgcatttgaatctgtatataaggaaattaaggagctgttaaagtaa

DBGET integrated database retrieval system