KEGG   Staphylococcus epidermidis RP62A: SERP1285Help
Entry
SERP1285          CDS       T00229                                 

Definition
glycerophosphoryl diester phosphodiesterase
Orthology
K01126  
glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ser00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1329229..1329975)
Genome map
AA seq 248 aa AA seqDB search
MKFRRPNQHFQIVAHRGLPEDYPENTIIAYRHALMLHIDMLEIDVHYTKDKELVVIHDDT
IDRTSNGKGKVSDFTLKELKALDFGFYKGEKFKGESIPTFDEVLDLADNFSQKLLIEIKK
PSQYPNIENMIVDKLKERQISKSKVILQSFDFDCVKKLSAMNLDYELGLLISKKKYWHKL
PNFKKIAKVADYANPNYQIVSKKFMQLAHEEELKVLPYTVNKLKESQKLIDIGVDGIISD
VPEDLFEL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcgacgtccaaatcaacatttccaaatcgtagcgcatagaggattacctgaa
gattatcctgaaaatactattatcgcttatcgacatgcgctcatgttacatatagatatg
ttggaaattgatgtacattacacaaaagataaagaacttgtcgttatacatgatgatact
atcgatcgtacgtcaaatggtaaaggtaaggtttctgattttactttaaaagaattaaaa
gcgttagattttggtttctataaaggagagaaatttaaaggggagagtataccgactttt
gatgaagtgttagatttagcagataacttttcacaaaaattattaatagaaataaaaaag
cctagtcagtatccaaatattgaaaatatgattgttgataaattgaaggaaagacaaata
tctaaatctaaagtgattttacaatcattcgattttgattgtgtaaaaaaattgtcagca
atgaatttagattatgaattaggtttattaattagtaagaaaaaatattggcacaagtta
ccaaatttcaaaaaaattgccaaagttgctgattatgctaatcctaattatcaaattgtt
tcgaagaaatttatgcaacttgctcatgaggaagagttaaaagtattaccttatactgta
aataaattaaaagaatcacaaaaattaatagatattggtgttgacggtattatttccgat
gtacctgaagatttatttgagctataa

DBGET integrated database retrieval system