KEGG   Staphylococcus epidermidis RP62A: SERP1320Help
Entry
SERP1320          CDS       T00229                                 

Definition
hypothetical protein
Orthology
K07139  
 
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1381468..1382421
Genome map
AA seq 317 aa AA seqDB search
MGNYFPYAFEDKRYHTWNYHLKNKFGQKIFKVALDGGFDCPNRDGTVAHGGCTFCSAAGS
GDFAGNRAEPIEVQFKKIKERMHEKWSEGQYIAYFQAFTNTHAPVEVLKEKYEPVLKEDG
VVGLSIATRPDCLPDDVVEYLAELNQRTYLWVELGLQTVHQSTSDLINRAHDMQTYYDGV
TKLRKHNINVCTHIINGLPGENYDMMMETAKEVAQMDVQGIKIHLLHLLKGTPMVKQYEK
GMLEFMSQQDYTNLVCDQLEVLPPEMIVHRITGDGPIDLMVGPMWSVNKWEVLNEIDNEL
TRRNSYQGKMNKQSIQS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactatttcccgtatgcctttgaagataaacgctatcacacatggaactatcat
ttaaaaaacaagtttggtcagaaaatatttaaggtcgcattagacggaggttttgattgc
ccaaatagagatggtactgtagctcatggaggttgcacattttgttctgcagcaggaagc
ggtgactttgcaggtaatagagctgaaccaattgaagttcaattcaaaaaaataaaagaa
cgtatgcatgaaaaatggagtgaaggtcaatatattgcatactttcaggcgtttacaaat
acgcatgcacctgttgaagtactaaaagaaaaatatgaacctgtcttaaaagaagatggc
gtcgttggtttatcaatcgcgacaagacctgattgtttgcctgatgatgttgtagaatat
ttagctgaacttaatcagcgcacttacttatgggtagaattgggcctacaaactgtgcat
cagtcaacttccgatttaataaatcgtgctcatgatatgcaaacatactatgacggcgta
acaaaattacgcaaacataatataaatgtttgtacgcacataatcaacggcttaccaggt
gaaaattatgacatgatgatggagactgctaaagaagtcgctcagatggacgttcaaggt
attaaaattcatttattacacttgctaaaaggaacgcctatggttaaacaatatgaaaaa
ggtatgctcgagtttatgagtcaacaagattataccaatcttgtttgtgatcaacttgaa
gtattacccccagaaatgattgtgcacagaatcactggagatggacctatagatctaatg
gtcggaccaatgtggagtgttaataaatgggaagtattaaatgaaattgataatgagctt
actagacgaaactcctatcaaggtaaaatgaacaagcagagtatacaatcatga

DBGET integrated database retrieval system