KEGG   Staphylococcus epidermidis RP62A: SERP1337Help
Entry
SERP1337          CDS       T00229                                 

Definition
hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1396194..1396502
Genome map
AA seq 102 aa AA seqDB search
MARSKKYFYLSLLMIILSFFFNTNNSLLSNIFQSFMKIVVVTSIVNIIILILSIVFADKS
IKYAKESSDWIRFASKILPLIILITIIIHILSSLHTFGYIFK
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atggctcggtcaaaaaagtacttttatcttagtctattaatgataattttaagttttttc
tttaataccaataattcattattgagtaatatatttcaatcgtttatgaaaattgttgta
gttacaagtatcgttaatattataatacttattttatcgattgtttttgccgataaatct
ataaagtatgctaaggaaagttcagattggattagatttgcaagcaaaatattaccattg
attattttaatcactattattatccatatactttcatctttacatacttttggttacatt
tttaaataa

DBGET integrated database retrieval system