KEGG   Staphylococcus epidermidis RP62A: SERP1370Help
Entry
SERP1370          CDS       T00229                                 

Definition
cadmium resistance family protein
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1427468..1428085)
Genome map
AA seq 205 aa AA seqDB search
MFETITTAAILYIATAVDLLVILLIFFARANNYQQYKDIYIGQYLGSLTLIFVSLFFAYV
LNYVPDKWILGLLGLIPIYLGIKVAIFDDCEGERRAKDELNKKGLSELSKSVAVVTLASC
GADNIGLFVPYFTTINNYELVITLITFVILIFILVFTAQKLANIPGLGEVIERFSRWIMS
IVYIGLGLFIIIENGTVQKLFHFVF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaacgataacgacagccgccatcctgtatattgctacagcggttgatttatta
gttatattattaatattttttgcaagagctaacaattatcaacagtataaagatatttat
attggacaatatctagggtcattaactttaatttttgtaagtttgttttttgcttatgta
cttaactatgtaccagataaatggattttaggattgcttggtcttataccaatttattta
ggaattaaggttgctatattcgatgattgtgaaggggaaagaagagctaaagatgaacta
aataaaaaaggattatctgagttatcaaaatctgtagcagtagtcacattagcaagttgt
ggtgcagataatataggattatttgtaccatatttcactaccataaataattatgaatta
gttatcactttaatcacatttgtaatcttaatttttattcttgtctttaccgctcaaaaa
ttggctaatatacctggcctaggtgaagtcattgaaagatttagtaggtggataatgtca
atagtctatattggtttaggactattcattatcattgaaaacggaacagttcaaaaactc
tttcattttgttttttag

DBGET integrated database retrieval system